KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_03769Help
Entry
TBSG_03769        CDS       T01690                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K07008  gamma-glutamyl hercynylcysteine S-oxide hydrolase [EC:3.5.1.118]
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Pathway
mtk00340  Histidine metabolism
mtk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    TBSG_03769
Enzymes [BR:mtk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.118  gamma-glutamyl hercynylcysteine S-oxide hydrolase
     TBSG_03769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_6 GATase_4
Motif
Other DBs
NCBI-ProteinID: AEB05898
Position
complement(4128403..4129104)
Genome map
AA seq 233 aa AA seqDB search
MCRHLGWLGAQVAVSSLVLDPPQGLRVQSYAPRRQKHGLMNADGWGVGFFDGAIPRRWRS
PAPLWGDTSFHSVAPALRSHCILAAVRSATVGMPIEVSATPPFTDGHWLLAHNGVVDRAV
LPAGPAAESVCDSAILAATIFAHGLDALGDTIVKVGAADPNARLNILAANGSRLIATTWG
DTLSILRRADGVVLASEPYDDDSGWGDVPDRHLVEVTQKGVTLTALDRAKGPR
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcgtcacctggggtggctcggggcacaggtcgcggtttcttcgttggtgctggac
ccgccgcagggtctgcgggtgcagtcatatgcgccgcgtcggcaaaagcacgggctgatg
aacgccgacggttggggtgtcggcttcttcgacggtgccattccccggcgttggcgcagc
ccggctccgctgtggggggacacgtcgtttcactcggtggcgccggcgctgcgtagtcac
tgcatcctcgccgcggtgcgctcggcgactgtcggtatgccgatcgaagtcagcgcgacc
ccgccgttcaccgatgggcactggttgctagcgcacaacggtgtggttgatcgtgccgtg
ttgccggcgggcccggcggccgaatcggtctgtgacagcgcgatactcgcggccaccatc
ttcgctcacggtctggacgctctgggagacaccattgtcaaggtcggcgcggccgaccca
aatgcccgactaaacatcttggcggccaacggttcccggctcatcgcgaccacctgggga
gacacgctgtccatcctgcggcgcgccgacggggtggtgctggccagcgaaccatacgac
gacgactccggttggggcgacgtgccggaccgccacctggtggaggtaacccaaaagggt
gtcacgctgaccgcattggaccgcgcgaaaggacctcgatga

DBGET integrated database retrieval system