KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_0225Help
Entry
CCDC5180_0225     CDS       T01992                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Pathway
mtl00071  Fatty acid degradation
mtl00072  Synthesis and degradation of ketone bodies
mtl00280  Valine, leucine and isoleucine degradation
mtl00310  Lysine degradation
mtl00362  Benzoate degradation
mtl00380  Tryptophan metabolism
mtl00620  Pyruvate metabolism
mtl00630  Glyoxylate and dicarboxylate metabolism
mtl00640  Propanoate metabolism
mtl00650  Butanoate metabolism
mtl00900  Terpenoid backbone biosynthesis
mtl01100  Metabolic pathways
mtl01110  Biosynthesis of secondary metabolites
mtl01120  Microbial metabolism in diverse environments
mtl01130  Biosynthesis of antibiotics
mtl01200  Carbon metabolism
mtl01212  Fatty acid metabolism
mtl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mtl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CCDC5180_0225
   00630 Glyoxylate and dicarboxylate metabolism
    CCDC5180_0225
   00640 Propanoate metabolism
    CCDC5180_0225
   00650 Butanoate metabolism
    CCDC5180_0225
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CCDC5180_0225
   00072 Synthesis and degradation of ketone bodies
    CCDC5180_0225
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCDC5180_0225
   00310 Lysine degradation
    CCDC5180_0225
   00380 Tryptophan metabolism
    CCDC5180_0225
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CCDC5180_0225
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCDC5180_0225
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CCDC5180_0225
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtl04147]
    CCDC5180_0225
Enzymes [BR:mtl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CCDC5180_0225
Exosome [BR:mtl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CCDC5180_0225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEJ49062
Position
290438..291760
Genome map
AA seq 440 aa AA seqDB search
MAPAAKNTSQTRRRVAVLGGNRIPFARSDGAYADASNQDMFTAALSGLVDRFGLAGERLD
MVVGGAVLKHSRDFNLMRECVLGSELSPYTPAFDLQQACGTGLQAAIAAADGIAAGRYEV
AAAGGVDTTSDPPIGLGDDLRRTLLKLRRSRSNVQRLKLVGTLPASLGVEIPANSEPRTG
LSMGEHAAVTAKQMGIKRVDQDELAAASHRNMADAYDRGFFDDLVSPFLGLYRDDNLRPN
SSVEKLATLRPVFGVKAGDATMTAGNSTPLTDGASVALLASEQWAEAHSLAPLAYLVDAE
TAAVDYVNGNDGLLMAPTYAVPRLLARNGLSLQDFDFYEIHEAFASVVLAHLAAWESEEY
CKRRLGLDAALGSIDRSKLNVNGSSLAAGHPFAATGGRILAQTAKQLAEKKAAKKGGGPL
RGLISICAAGGQGVAAILEA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtggcccctgctgctaagaacacttcacagaccaggcggcgagtcgccgtactgggcggc
aaccgcatcccgttcgccagatcggacggtgcctacgcggatgcgtccaaccaggacatg
ttcaccgcggcgctgagcggcttggtggaccgattcggactcgccggcgagcggctggac
atggtggtgggcggtgcggtgctcaaacacagccgcgacttcaatctaatgcgcgaatgc
gtgctgggctccgaactctcgccgtacacgccggcgttcgacctgcagcaggcctgcggg
acgggcctgcaggccgcgatcgcggccgccgacggcattgccgccgggcggtatgaggtg
gccgccgctggcggggtggacaccacctcggacccgccgatcggcctgggcgacgacctg
cgccgcaccctgctcaagctgcgccgatctaggtccaacgtgcaacgcctcaagctggtg
ggcacgctgccggccagcctgggcgtggagatccccgccaacagcgagccgcgcaccggg
ctgtcgatgggcgagcacgccgccgtcaccgccaagcagatgggcatcaaacgcgtagac
caggacgagctggccgccgccagccatcgcaatatggccgacgcctacgaccggggtttc
ttcgacgacctggtcagtccgtttttagggctgtaccgagacgacaatctgcggcctaac
tccagcgtcgagaaactggccacgctgcgtccggtcttcggagtgaaggccggtgacgcg
acgatgacggccggcaattcgactccgctgaccgacggcgcctcggtggcattgctggcc
agcgaacagtgggcggaggcacactcgctggctccgctggcctatctcgtggatgccgag
accgccgcggtcgactatgtcaacggcaacgacggcctgttgatggcgccgacctacgcg
gtaccccggctgctggcccgtaacgggttgagcctgcaggacttcgacttctacgaaatc
cacgaggcgtttgcctccgtggtgctcgcgcatctggcggcgtgggagtccgaggagtac
tgcaagcggcggctgggcctggacgccgcgctggggtcgatcgatcggtccaagctcaac
gtcaacgggtcgtcgttggccgccgggcaccccttcgcggcgaccggtgggcggattttg
gcgcagaccgccaagcagctcgccgagaagaaggcggcgaaaaaaggcggcggaccgctg
cgcgggctgatttcgatctgcgcggccggcggccaaggtgtggccgcgattttggaggcc
tga

DBGET integrated database retrieval system