KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_0451Help
Entry
CCDC5180_0451     CDS       T01992                                 

Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Pathway
mtl00010  Glycolysis / Gluconeogenesis
mtl00260  Glycine, serine and threonine metabolism
mtl00680  Methane metabolism
mtl01100  Metabolic pathways
mtl01110  Biosynthesis of secondary metabolites
mtl01120  Microbial metabolism in diverse environments
mtl01130  Biosynthesis of antibiotics
mtl01200  Carbon metabolism
mtl01230  Biosynthesis of amino acids
Module
mtl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mtl_M00002  Glycolysis, core module involving three-carbon compounds
mtl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mtl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CCDC5180_0451
  Energy metabolism
   00680 Methane metabolism
    CCDC5180_0451
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CCDC5180_0451
Enzymes [BR:mtl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CCDC5180_0451
Membrane trafficking [BR:mtl04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CCDC5180_0451
Exosome [BR:mtl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CCDC5180_0451
  Exosomal proteins of melanoma cells
   CCDC5180_0451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEJ49288
Structure
PDB: 

Position
574104..574874
Genome map
AA seq 256 aa AA seqDB search
MRERLAGMANTGSLVLLRHGESDWNALNLFTGWVDVGLTDKGQAEAVRSGELIAEHDLLP
DVLYTSLLRRAITTAHLALDSADRLWIPVRRSWRLNERHYGALQGLDKAETKARYGEEQF
MAWRRSYDTPPPPIERGSQFSQDADPRYADIGGGPLTECLADVVARFLPYFTDVIVGDLR
VGKTVLIVAHGNSLRALVKHLDQMSDDEIVGLNIPTGIPLRYDLDSAMRPLVRGGTYLDP
EAAAAGAAAVAGQGRG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgagagacttgccggtatggcaaacactggcagcctggtgttgctgcgccacggc
gagagcgactggaatgccctcaacctgttcaccggctgggtcgatgtcggcctgacggac
aagggccaggcagaggcggttcgaagcggcgagctgatcgcggaacacgacctattgccc
gacgtgctctacacctcgttgctgcggcgcgcgatcaccaccgcgcatctggcgttggac
agcgccgatcggctctggattcccgtgcggcgtagctggcggctcaacgaacgccactac
ggcgcgctgcagggtttggacaaggccgagaccaaggcccgctatggcgaagagcagttc
atggcctggcggcgcagctatgacacgccgccgccgccgatcgagcggggcagtcagttc
agccaggacgccgaccctcgttacgccgacatcggcggtggcccgctcaccgaatgtctg
gctgacgtggtcgcccggtttttgccatatttcaccgacgtcatcgttggcgacttgcgg
gtcggcaagacggtgctgatcgttgcccacggcaactcgttgcgcgcgctggtcaagcac
ctggaccagatgtctgacgacgaaatcgtcggactgaacatcccgaccggaattccgctg
cgctacgacctggattccgcgatgaggccgctggtgcgcggtggtacgtatctggacccg
gaggcggcagccgccggcgccgccgcggtggccggccagggccgcgggtaa

DBGET integrated database retrieval system