KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_0923Help
Entry
CCDC5180_0923     CDS       T01992                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Pathway
mtl00450  Selenocompound metabolism
mtl00970  Aminoacyl-tRNA biosynthesis
mtl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CCDC5180_0923
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CCDC5180_0923
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mtl01007]
    CCDC5180_0923
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mtl03016]
    CCDC5180_0923
Enzymes [BR:mtl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CCDC5180_0923
Amino acid related enzymes [BR:mtl01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CCDC5180_0923
Transfer RNA biogenesis [BR:mtl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CCDC5180_0923
 Prokaryotic type
   Other AARSs
    CCDC5180_0923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AEJ49760
Structure
PDB: 

Position
complement(1121602..1123161)
Genome map
AA seq 519 aa AA seqDB search
MKPYYVTTAIAYPNAAPHVGHAYEYIATDAIARFKRLDGYDVRFLTGTDEHGLKVAQAAA
AAGVPTAALARRNSDVFQRMQEALNISFDRFIRTTDADHHEASKELWRRMSAAGDIYLDN
YSGWYSVRDERFFVESETQLVDGTRLTVETGTPVTWTEEQTYFFRLSAYTDKLLAHYHAN
PDFIAPETRRNEVISFVSGGLDDLSISRTSFDWGVQVPEHPDHVMYVWVDALTNYLTGAG
FPDTDSELFRRYWPADLHMIGKDIIRFHAVYWPAFLMSAGIELPRRIFAHGFLHNRGEKM
SKSVGNIVDPVALAEALGVDQVRYFLLREVPFGQDGSYSDEAIVTRINTDLANELGNLAQ
RSLSMVAKNLDGRVPNPGEFADADAALLATADGLLERVRGHFDAQAMHLALEAIWLMLGD
ANKYFSVQQPWVLRKSESEADQARFRTTLYVTCEVVRIAALLIQPVMPESAGKILDLLGQ
APNQRSFAAVGVRLTPGTALPPPTGVFPRYQPPQPPEGK
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgaagccctattacgtcaccaccgcgatcgcatatcccaacgctgcaccccacgtaggt
cacgcctacgaatacatcgccaccgacgcgatcgcccggttcaaacggctggatggctat
gacgtgcgcttcctgaccgggaccgacgagcatggcctgaaggtcgcacaagccgccgcg
gcagcgggcgtgcccaccgcggcgcttgcccggcgcaattccgacgtgtttcagcgcatg
caggaggcgctgaacatctccttcgaccgattcatccgcactaccgatgccgaccaccac
gaggcgtccaaggaactctggcgacggatgtcggcggccggcgacatctatctggacaac
tattccgggtggtactcggtgcgcgacgagcggttcttcgtcgaatcggagacccaactt
gtcgacggcacgcgcctgacggtagagaccggcacgccggtgacctggaccgaggagcag
acctacttcttccggctgtcggcctataccgacaagctgctggcccactatcacgccaac
cccgacttcatcgcgccggagacgcggcgcaacgaagtgatcagcttcgtctccggcggc
ctggacgacctgtcgatctcgcgcacctcgtttgactggggtgtgcaggtgcccgagcac
cccgaccacgtcatgtacgtctgggtcgacgcgctgaccaattacctgaccggggcgggc
ttcccggataccgactcggagttgttccgccgctactggcccgccgatttgcacatgatc
ggcaaggacatcatcaggtttcatgccgtctattggccggcgtttttgatgtcagccgga
atcgagttgccgcgaaggatcttcgcgcacgggttcttgcacaaccgcggcgagaagatg
agtaaatcggtgggcaacatcgtcgacccggttgccctggcggaagcgctcggggtggac
caggtccgctacttcctgttgcgggaggtcccgttcggccaggacggcagttacagcgac
gaggccatcgtcactcggatcaacaccgatctggccaacgagctcggcaacttggcccaa
cgctcgttgtcgatggtggccaaaaaccttgacggcagggtgcccaacccgggtgagttc
gccgacgccgacgccgcgctgcttgcgaccgccgatggcttgttggagcgagtgcgcggt
cacttcgacgcacaggcgatgcacctggcgctggaggcgatctggctgatgctcggcgac
gcgaacaagtacttttcggtgcagcagccgtgggtactgcgcaagagcgagtccgaagcc
gatcaggcccggttccgcaccacgctctacgtcacctgcgaggtagtccgcatcgcggca
ctgctgatccagccggtgatgccggagtcggccggcaaaattttggacctgctcggccag
gccccaaaccagcggtcgttcgccgccgtaggtgttcggctgacccccggcacagcgctg
ccgccgcccaccggggtatttccccgctaccagccgccgcaaccacccgaaggcaagtga

DBGET integrated database retrieval system