KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_0992Help
Entry
CCDC5180_0992     CDS       T01992                                 

Definition
(GenBank) Mycothiol conjugate amidase Mca (Mycothiol S-conjugate amidase)
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Brite
KEGG Orthology (KO) [BR:mtl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CCDC5180_0992
Enzymes [BR:mtl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     CCDC5180_0992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L
Motif
Other DBs
NCBI-ProteinID: AEJ49829
Position
1202899..1203765
Genome map
AA seq 288 aa AA seqDB search
MSELRLMAVHAHPDDESSKGAATLARYADEGHRVLVVTLTGGERGEILNPAMDLPDVHGR
IAEIRRDEMTKAAEILGVEHTWLGFVDSGLPKGDLPPPLPDDCFARVPLEVSTEALVRVV
REFRPHVMTTYDENGGYPHPDHIRCHQVSVAAYEAAGDFCRFPDAGEPWTVSKLYYVHGF
LRERMQMLQDEFARHGQRGPFEQWLAYWDPDHDFLTSRVTTRVECSKYFSQRDDALRAHA
TQIDPNAEFFAAPLAWQERLWPTEEFELARSRIPARPPETELFAGIEP
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaactgcggttgatggcggtgcacgcccaccccgatgacgagtccagcaagggc
gcggccaccctggcgcgctacgccgacgagggtcatcgcgtgctggtggtgacgttgacc
ggtggtgagcgcggcgagatcctcaacccggcgatggacctgccggacgtgcatgggcgc
atcgccgagatccggcgtgacgagatgaccaaggcggccgagatcctcggtgtcgagcac
acctggctgggcttcgtcgactccgggctacctaagggtgatttaccgccaccgctgcct
gatgactgcttcgcgcgggtaccgctggaggtgtccaccgaggcgctggtgcgggtggtt
cgcgagtttcggccgcacgtgatgaccacctacgacgagaacggcggctacccacatccc
gaccacattcgctgccatcaggtttcggtggctgcctacgaggcggccggtgacttttgc
cggtttcccgacgcgggtgagccgtggacggtgtccaagctgtactacgtccacggcttc
ctgcgggagcggatgcagatgttgcaggatgagttcgcccggcacggccaacgcggccca
ttcgaacaatggctggcgtactgggaccccgaccatgactttctcaccagccgagtgacc
acccgggtcgagtgctcgaaatacttcagccaacgcgacgatgcgttgcgcgcgcatgcc
acccagatcgacccgaacgccgaattcttcgccgccccgcttgcctggcaggagcggctg
tggccgaccgaggaattcgagttggctcgctcgcgtatccccgcgcgcccaccggagacc
gaattgttcgccgggatcgagccgtga

DBGET integrated database retrieval system