KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_1085Help
Entry
CCDC5180_1085     CDS       T01992                                 

Definition
(GenBank) polyketide beta-ketoacyl synthase pks4
  KO
K12432  mycolipanoate synthase [EC:2.3.1.252]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Brite
KEGG Orthology (KO) [BR:mtl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mtl01004]
    CCDC5180_1085
Enzymes [BR:mtl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.252  mycolipanoate synthase
     CCDC5180_1085
Lipid biosynthesis proteins [BR:mtl01004]
 Others
  Multifunctional type
   CCDC5180_1085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_1 ketoacyl-synt KR PS-DH Ketoacyl-synt_C ADH_zinc_N ADH_zinc_N_2 KAsynt_C_assoc PP-binding adh_short Thiolase_N ADH_N NMT1_3
Motif
Other DBs
NCBI-ProteinID: AEJ49922
Position
1309884..1316141
Genome map
AA seq 2085 aa AA seqDB search
MRTATATSVAVIGMACRLPGGIDSPQRLWEALLRGDDLVGEIPADRWDANVYYDPEPGVP
GRSVSRWGAFLDDVGGFDCDFFGLTEREATAIDPQHRLLLEVSWEAIEHAGVDPATLAES
QTGVFVGLTHGDYELLSADCGAAEGPYGFTGTSNSFASGRVAYTLGLHGPAVTVDTACSS
GLTAVHQACRSLDDGESDLALAGGVVVTLEPRKSVSGSLQGMLSPTGRCHAFDEAADGFV
SGEGCVVLLLKRLPDAVRDGDRVLAIVRGTAANQDGRTVNIAAPSAQAQIAVYQQALAAA
GVEASTVGMVEAHGTGTPVGDPVEYASLAAVYGTEGPCALTSVKTNFGHLQSASGPLGLM
KTILALRHGVVPQNLHFCRLPDQLAEIGTELFVPQANTSWPDNTGQPRRAAVSSYGMSGT
NVHAILEQAPVSEPAASGPELTPEAGGLALFPVSATSAEQLHVTAARLADWVDQNGNAGS
RVSMRDLGYTLSCRRAHRPVRTVVTASSFDELSAALRDVAGDQIPYQPAVGHDDRGPVWV
FSGQGSQWPGMGTELLVAEPVFAATVAAMEPVIARESGFSVTEAMSAPQTVSGIDRVQPT
IFAVQVALAAALKSYGVRPGAIIGHSLGEAAAAVVAGALSLHDGLRVICRRSRLMSRIAG
SGAMASVELPGQQVLSELAIRGISDVVLSVVASPTSTVVGGATQSIRDLVAAWEQQDVLA
REVAVDVASHTPQVDPILDELLEVLAEVDPTAPEIPYYSATLWDPRERPSFTGEYWVENL
RYTVRFAAAVQAALKDGYRVFGELAPHPLLTYAVEQNAASLDMPIATLAAMRRGEQLPFG
LRGFVADVHNAGAKVDFSVQYPDGRLVDAPLPSWTHRTLMLSREDSHRSHTGAVQAVHPL
LGAHVHLLEEPERHVWQAGVGTGAHPWLGDHRIHNVAAFPGAAYCEMALAAARTTLGELS
EVRDIKFEQTLLLDEQTVVSSAATIAAPGILQFAVESHQEGEPARRASAMLHALEEMPQP
PGYDTNALTAAHESSMSGEELRKMFNSLGIQYGPAFSGLVAVHTARGDVTTVLAEVALPG
AIRSQQSAYASHPALLDACFQSVLVHPEVQKATVGGLMLPVGVRRLRNYHSTRSAHYCLA
RVTSSSRAGECEADLDVFDQAGTVLLTVEGLRLAAGISEHERANRVFDERLLTIEWERGE
LPEVPQIDAGSWLLLSASEADPLTAQLADALNAVGAQSTSVASASDVAQLRSLLGGRLTG
VVVVTGPPTGGLTQCGRDYVSQLVGIARELAELPGEPPRLFVVTRSAASVLPSDLANLEQ
AGLRGLMRVIDSEHPHLGATAIDVDNDETVAALVASQLQSGSQEDETAWRNGIWYTARLR
PGPLRPAERRTAVVEYRRDGMRLQIRTPGDLESLEFVTFDRVAPGPGEIEVAVTASSVNF
ADVLVAFGRYPTFEGYRQQLGIDFAGVVTAVGPDVTEHRIGDHVGGMSANGCWSTFVRCD
ARLAVTLPPELPVAAAAAVPTASATAWYALHDLARICSDDKVLIHSGTGGVGQAAIAIAR
AAGCEIFATAGSAQRRQLLHDMGVEHVYDSRSTEFAEQIRGDTDGYGVDVVLNSLPGAAQ
RAGIELLAFGGRFVEIGKRDIYGDTRLGLFPFRRNLSLYAVDLALLTHSHPHTVRRLLKT
VYQHTVEGTLPVPQTTHYPIHDAAVAIRLVGGAGHTGKVVLDVPRTGEGVAVVPPEQVRT
SRPDGAYLVTGGLGGLGLFLAGELAAAGCGRIVLNSRSTPSPHATRVIERLRAAGADIQV
ECGDIADAATAHRVVAVATASGLPVRGVLHAAAVVEDATLANVTDELIDRCWAPKVHGAW
NIHRATAAQPLEWFCLFSSAAALVGSPGQGAYAAANSWLDAFAHWRRAQGLPATSIAWGA
WAEIGRATALAEGTGAAIAPAEGARAFQTLLRYGRAYSGYAPIMGTPWLTAFAQRSRFAE
AFHATGQNQPATGKFLAELGSLPREEWPRTVRRLVSDQISLLLRRTIDPDRPLSDYGLDS
LGNLELRTRIETETGIRVSPTKITTVRGLAEHVCDELAAAQSAPV
NT seq 6258 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcaccgcaaccgccacatcggtcgccgttatcggcatggcttgccggctcccgggc
ggcatcgattccccacaacgcctctgggaagcgctgttacgcggcgacgatttggtgggt
gagattcccgctgaccggtgggacgcgaacgtgtactacgaccccgaacctggtgtccct
ggtcgatcggtatcgcgttggggcgcctttctggacgacgtcggcgggtttgactgcgat
ttcttcggcctgaccgagcgggaggcgaccgcgatcgacccacagcaccgcttgctgctg
gaagtgtcgtgggaggctatcgagcacgcgggtgtggacccggcgacgctcgctgaatca
caaacaggtgtcttcgtaggactgacacacggcgactacgagctgctgtccgcggattgc
ggcgccgcggaaggaccgtacggattcaccggcaccagtaacagtttcgcgtccgggcga
gtggcctacacactcggactgcatggccccgcggtcacggtggacaccgcgtgctcgtcc
gggttgacggctgtgcatcaagcctgccgcagcctggatgacggtgaaagcgatctcgct
cttgccggtggtgtggttgtcacgctagaaccgcggaagtccgtctcgggttccctgcaa
ggcatgttgtcgcctaccgggcgttgccatgccttcgacgaagcagctgatggcttcgtg
tccggtgaggggtgcgtggtcctgctgctgaagcggctaccggatgcggtgcgcgacggt
gatcgtgtgctggcgatcgttcgtggcaccgcagccaaccaggatggccgcaccgtgaat
atcgcggcgccgtcggcgcaggctcagatcgcggtgtatcagcaagcgttggctgcagcg
ggcgtcgaagcgtcgacggtggggatggtcgaagcccacggcaccggcacccccgttgga
gatccggtcgaatacgcgagcctggccgcggtgtacggaaccgagggtccgtgcgcgctg
acgtcggtgaaaacaaacttcggtcacctgcagtcggcatcggggcccctggggttgatg
aagacaatcctggcgttgcggcatggggttgtgccgcagaacctgcacttctgccggctg
cctgatcagctggctgagattggcactgaactctttgtgccgcaagcgaatacatcctgg
ccggacaacaccggacagccacgtcgcgctgcggtttcctcgtatggaatgtcgggtacc
aacgtgcatgccatcttggagcaagcgccggtatcagaaccagcggcttcgggacctgag
ctcactcccgaagccggtgggctggcgttgtttccggtgtcggctacctcggctgagcaa
ctacacgtcacggccgcccggctggcggattgggtcgaccagaacggcaacgcgggcagt
cgagttagcatgcgggacctgggctacacgctgtcctgccgccgtgcacaccgacccgtc
cggacggttgtgacggcgagcagttttgacgagctgagcgcggcgctgcgggacgtcgct
ggcgatcagattccctatcagcccgcagtggggcacgacgaccgcgggccggtgtgggtg
ttctccgggcaaggctctcagtggcccgggatgggcactgaactgctggtagccgaaccg
gtgttcgccgccaccgtcgcggcgatggagccggtgatcgctagggagtcagggttttcg
gtgaccgaagcgatgtcggcgccacagacggtcagcggtattgaccgggtgcagcccacc
atcttcgcggtgcaggtcgccctggccgcggccctgaagtcgtatggggtacgtcctggt
gccatcatcgggcactcgctcggcgaggctgcggcagccgtggtcgccggagcactgtcg
ctgcacgacggattgcgagtcatctgccggcgctcgcggctgatgtcgcgcatcgccggt
agtggcgcgatggcatcggtggaactgcccggccaacaagtgttgtcagaacttgcgatt
cgtgggatctccgacgtcgtgctctcggtggttgcctctccgacctcaaccgtcgtcggc
ggcgccacgcagtcgatacgtgacctggtggcggcctgggagcagcaggatgtgctggca
cgcgaggtagctgtggacgtcgcttcacatacaccgcaggtcgatcccatcctggacgag
ttgctcgaggtcctggccgaggtcgatccgacggcgccggaaattccgtattactccgca
acgttgtgggatccgcgcgagcgaccgtcgttcaccggcgagtactgggtggaaaacctg
cggtacacggtgcgattcgcggcggcggtacaggccgcgctcaaggacgggtaccgagtg
ttcggcgagctggctccgcatccgctgctcacctacgcggtcgagcagaacgccgccagt
ctcgacatgccgatcgcaacgcttgccgcgatgcggcgcggggaacagctgccgttcggg
ttgcgcggcttcgtcgccgacgtgcacaacgccggcgccaaggtggacttctctgtccag
taccctgatgggcgcttggtggatgcgccattgccgagctggacgcaccgcaccctgatg
ctcagccgtgaggattcacaccgctcgcacaccggcgcggtccaggcggttcatccgctg
cttggggcccatgtgcacctgttggaggaaccggagcgtcacgtctggcaggccggggtt
ggcaccggggcgcatccgtggctcggtgaccatcggatacacaacgtggctgcgtttccc
ggtgcggcctactgtgagatggcattggccgcggcgcgcaccactcttggcgagctgtcg
gaggtgcgcgacatcaagttcgagcagacgctgttgctggacgagcagacggtggtctca
tcggccgcgacgatcgccgcgcctgggatcctacagttcgcagtcgagagtcatcaggaa
ggcgagcccgcacggcgggccagcgcgatgctgcacgcattggaggagatgccgcagccg
cccgggtacgacacgaacgctctgaccgccgcccatgagtccagcatgagcggtgaggaa
ctgcgaaaaatgtttaacagcttaggtattcagtatggtccggctttttcaggcctagtt
gcggtgcacacggcgcgcggggacgtcaccacagtgctcgccgaggtcgcgctgcctgga
gccatccgatctcagcagtcggcatatgccagccacccggccctgcttgatgcgtgtttc
cagtcggtgcttgttcatcccgaggtccagaaggcgactgtcggtggtctgatgctgccc
gtgggcgtgcgtaggctgcgcaactatcactcgacgcgcagcgcgcactactgcctcgcc
cgggtcacgtcatcgtcgcgagccggcgaatgcgaagccgatctcgacgtgttcgaccag
gccggaacggtacttttgaccgtcgagggattacggctggccgcagggatttccgaacat
gaacgcgcgaaccgggtgttcgacgagcgattgttgaccatcgagtgggagcggggtgag
ctgcctgaggtgccgcagatcgatgcgggatcctggctgctgctcagtgcgtccgaagct
gatccgctgaccgcgcaactcgccgacgcgttgaatgccgttggtgcccagagcactagc
gtggcttcggcgtcggatgtcgcacaattgcgttcgctgctcggaggcaggctcaccggt
gttgtcgtggtgactggcccgccaacgggtggtttgacacagtgcggccgcgactatgtg
tcacagctggtgggtattgcccgcgagctcgcggagctgcccggtgagccgccgcggctg
ttcgtggtgaccaggagcgcggcgagcgtgttgccgagcgatcttgccaacttggaacag
gcgggattgcgtggactgatgcgggtgatcgattccgagcatccgcacctgggtgccacc
gcaatcgacgtcgacaacgacgagaccgtcgctgccctggtggccagccaactacagagc
gggtcgcaggaggacgaaaccgcttggcgcaatggcatttggtacaccgcccggctgcgt
cccggtccgttacgcccggccgaacggcgaaccgccgtcgtcgaatacagacgcgacggt
atgcgcctgcagatccgcactcccggcgacctcgagtcgttggagttcgtcacattcgac
cgggtcgcgccgggaccgggcgagatcgaggtcgcggtgaccgcatcgagtgtcaacttc
gccgacgttctggtcgctttcgggcggtatcccaccttcgagggctaccgacagcagttg
ggcatcgacttcgccggtgtggtgaccgcggtcgggccggatgtcaccgagcatcggatc
ggtgatcacgtcggcggcatgtccgccaatggctgctggagcacattcgtcagatgcgat
gcccggctggcggtgacgctcccgcccgagctgccggtggccgccgccgccgcggtaccg
accgcctccgcgacggcttggtacgccctgcacgatctggctcgcatctgctcggacgac
aaggtgctgattcactcggggaccggtggtgtcgggcaggcggcgatcgcgatcgcacgg
gccgccggatgcgagatcttcgccaccgcgggcagtgcccagcggcgacaactgctgcac
gacatgggtgtcgagcatgtctacgactcacggagcaccgagttcgccgagcagatccga
ggcgacaccgatgggtatggtgtcgacgtcgtactcaactcgctgcccggcgccgcacaa
cgtgctgggatcgaattgctggcctttggcgggcgattcgtggagatcggcaaacgtgac
atctacggcgacactcggctcgggttgttcccgttccgccgcaacctgtcgctgtatgcc
gtcgacttggcgctgctgacacacagccacccgcacaccgtccggcgcctgctgaaaacc
gtctaccaacacacggtcgagggcacgctgccggtgccgcagaccacgcactatcccatt
cacgacgctgccgttgccattcgtttggtcggcggagccgggcacaccggaaaagtggtg
ctcgatgtgccgcgtaccggtgaaggcgtggccgtggtgccccccgaacaggtccgcacg
tcccggcccgacggcgcctatctcgtcaccggtggtttgggcggcctcggcctgttcctt
gccggcgagctggcggcggcgggctgcggacgcatcgtgctcaactcccgttcgacgccc
agcccgcacgccaccagggtcatcgagcggctccgcgccgccggtgctgatatccaggtg
gaatgcggtgacatcgctgatgccgcaacggcccaccgagtggtggcggtggccaccgcc
tcgggcttgccggtgcgcggcgtgctgcacgcggcggcggtggtcgaggacgctacgttg
gccaatgtcaccgacgaacttatcgaccgctgttgggcgccgaaggtacacggcgcgtgg
aacattcatcgggccaccgccgcgcagccactggagtggttctgcttgttctcctcggcc
gcggccttggtgggctcgccgggtcaaggcgcatatgcggcggccaacagctggttggac
gcttttgcccactggcggcgggcgcagggccttccggctacctcaatcgcctggggagca
tgggccgagattggccgcgctaccgcgctggccgaaggcaccggcgcagcgatcgcgccc
gccgagggtgctcgagccttccagacgctgcttcgctacggccgggcgtactccggctat
gccccgatcatgggtaccccatggttgacggcctttgcgcaacgtagccgatttgccgaa
gcgttccacgccacgggccaaaatcaaccggccaccgggaaattcctcgccgaactgggc
agcttgccccgcgaagagtggccccgcacagtcaggcggttggtatcggaccagatcagc
ctgctgctgcggcgaaccattgatccggaccggccgctgtccgactatggtttggattcc
ttgggcaacttggagttgcggacccgcatcgaaaccgaaacgggtatacgcgtcagtccc
acaaagatcaccacggttcgcggcttggccgagcacgtgtgcgacgagctggcagccgcc
caatctgcgccggtctga

DBGET integrated database retrieval system