KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_1478Help
Entry
CCDC5180_1478     CDS       T01992                                 

Definition
(GenBank) tryptophan synthase, alpha subunit trpA
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Pathway
mtl00260  Glycine, serine and threonine metabolism
mtl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mtl01100  Metabolic pathways
mtl01110  Biosynthesis of secondary metabolites
mtl01130  Biosynthesis of antibiotics
mtl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CCDC5180_1478
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CCDC5180_1478
Enzymes [BR:mtl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CCDC5180_1478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth BtpA
Motif
Other DBs
NCBI-ProteinID: AEJ50315
Structure
PDB: 

Position
1802231..1803040
Genome map
AA seq 269 aa AA seqDB search
MAVEQSEASRLGPVFDSCRANNRAALIGYLPTGYPDVPASVAAMTALVESGCDIIEVGVP
YSDPGMDGPTIARATEAALRGGVRVRDTLAAVEAISIAGGRAVVMTYWNPVLRYGVDAFA
RDLAAAGGLGLITPDLIPDEAQQWLAASEEHRLDRIFLVAPSSTPERLAATVEASRGFVY
AASTMGVTGARDAVSQAAPELVGRVKAVSDIPVGVGLGVRSRAQAAQIAQYADGVIVGSA
LVTALTEGLPRLRALTGELAAGVRLGMSA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
gtggcggtggaacagagcgaagcaagtaggctcgggccggttttcgattcctgccgtgca
aacaaccgcgcggcattgattggttacttgccgaccgggtacccggacgtgccagcgtcg
gtggccgcgatgacagcgctagttgaatccggttgcgacattatcgaagtcggggttccg
tattcggacccgggcatggacggccccaccatcgccagggcaaccgaggcggcgctccgt
ggcggggtgcgagtccgggatacgttagccgcggtcgaggccatcagtatcgccggcggg
cgtgcggtagtgatgacctactggaatccggtgctgcgctatggggttgatgcattcgcg
cgggatctggcggcggccggaggactcggcctgatcactcctgacctcattcccgacgag
gcgcaacagtggctggcggcatccgaagagcatcggttggatcgcattttcttggtcgcg
ccgtcctcgacaccggagcggttggcggccaccgtcgaggcttcacgcgggttcgtctac
gcggcgtcgacgatgggggtgaccggggcgcgggatgcggtgtcgcaggcggcacccgaa
ctggtgggccgggtgaaggcggtgtctgacataccggtgggcgtcggtctgggtgtgcgg
tcgcgcgctcaagccgcgcagatcgcccaatacgccgacggtgtcatcgttggttccgca
ttggtgacggcgctaaccgaggggttgcctagattgcgggcactgaccggagagctcgct
gccggggtacgactagggatgtccgcatga

DBGET integrated database retrieval system