KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_2581Help
Entry
CCDC5180_2581     CDS       T01992                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Pathway
mtl00020  Citrate cycle (TCA cycle)
mtl00620  Pyruvate metabolism
mtl01100  Metabolic pathways
mtl01110  Biosynthesis of secondary metabolites
mtl01120  Microbial metabolism in diverse environments
mtl01130  Biosynthesis of antibiotics
mtl01200  Carbon metabolism
Module
mtl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mtl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mtl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CCDC5180_2581
   00620 Pyruvate metabolism
    CCDC5180_2581
Enzymes [BR:mtl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     CCDC5180_2581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AEJ51418
Position
complement(3141423..3142904)
Genome map
AA seq 493 aa AA seqDB search
MSDLARTDVVLIGAGIMSATLGVLLRRLEPNWSITLIERLDAVAAESSGPWNNAGTGHSA
LCEMNYTPEMPDGSIDITKAVRVNEQFQVTRQFWAYAAENGILTDVRSFLNPVPHVSFVH
GSRGVEYLRRRQKALAGNPLFAGTEFIESPDEFARRLPFMAAKRAFSEPVALNWAADGTD
VDFGALAKQLIGYCVQNGTTALFGHEVRNLSRQSDGSWTVTMCNRRTGEKRKLNTKFVFV
GAGGDTLPVLQKSGIKEVKGFAGFPIGGRFLRAGNPALTASHRAKVYGFPAPGAPPLGAL
HLDLRFVNGKSWLVFGPYAGWSPKFLKHGQISDLPRSIRPDNLLSVLGVGLTERRLLNYL
ISQLRLSEPERVSALREFAPSAIDSDWELTIAGQRVQVIRRDERNGGVLEFGTTVIGDAD
GSIAGLLGGSPGASTAVAIMLDVLQKCFANRYQSWLPTLKEMVPSLGVQLSNEPALFDEV
WSWSTKALKLGAA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagacctagccagaaccgacgtcgtgctgatcggtgcgggcatcatgagcgccacg
ctgggggtgctgctgcgtcggctcgaaccgaactggtcaatcaccctgatcgaacggctg
gacgcggtagccgccgaaagcagcggtccctggaacaacgccggcaccgggcactccgcg
ctgtgcgagatgaactacaccccagaaatgccggacggctcgatcgacatcaccaaagcg
gtgcgtgtcaacgagcaattccaggtcacccgccagttctgggcatacgcggccgaaaac
ggcatcctcaccgacgtgcgcagcttcctcaaccctgtgccgcacgtgagtttcgtccat
ggatcgcggggcgtcgagtatctacggcgccgccaaaaggcgttggccggcaacccgctg
ttcgccggcaccgagttcatcgagagtcccgacgaattcgcccgccggctgccgttcatg
gccgctaaacgggccttctccgagccggtggcgctcaactgggccgccgacggcaccgac
gtcgacttcggtgccctcgccaaacaactcatcggctattgcgtgcaaaatggcactacc
gcgttgttcgggcacgaggttcgcaacctctcgcggcaatccgacggcagctggacggtc
accatgtgcaaccgccggaccggcgaaaagcgcaagttgaacaccaagttcgtctttgtc
ggggccgggggtgacaccttgccggtgctgcagaaatccgggatcaaagaggtcaaaggc
ttcgccggcttcccgattggcggtcggttcctgcgcgccgggaacccggcgctcaccgcc
tcgcatcgggcaaaggtatatggcttcccggcgccgggcgccccgccgttgggcgccttg
catctggatctgcggtttgtcaacggcaagtcgtggctggtgttcgggccatacgccggc
tggtcgccgaagttcttgaaacacgggcagatcagcgacctgccccggtcgatcaggccg
gacaatctgttgtccgtgctcggcgtgggcctcaccgagcggagactgctgaactacttg
atcagccagctgcgtctctctgaacccgagcgggtcagtgcgctgcgcgaattcgcccct
agcgcaatcgattcggactgggagttgacgatagccggtcagcgggtacaggtgatccgg
cgagatgaacgcaacggcggggtgctcgagttcggcacgacggtcatcggcgatgctgac
ggtagtattgccggactactgggcggctccccaggggcttcgaccgcggtggcgatcatg
ctggacgtgctgcagaaatgctttgccaaccgctatcaatcctggctgcccacgctcaaa
gaaatggtgccgtcgctgggggtgcagctgtcgaatgaacccgcgctgttcgacgaggtg
tggtcatggagcaccaaggcgctgaagttaggtgccgcatga

DBGET integrated database retrieval system