KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_3002Help
Entry
CCDC5180_3002     CDS       T01992                                 

Definition
(GenBank) piperideine-6-carboxylic acid dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Pathway
mtl00010  Glycolysis / Gluconeogenesis
mtl00053  Ascorbate and aldarate metabolism
mtl00071  Fatty acid degradation
mtl00280  Valine, leucine and isoleucine degradation
mtl00310  Lysine degradation
mtl00330  Arginine and proline metabolism
mtl00340  Histidine metabolism
mtl00380  Tryptophan metabolism
mtl00410  beta-Alanine metabolism
mtl00561  Glycerolipid metabolism
mtl00620  Pyruvate metabolism
mtl00625  Chloroalkane and chloroalkene degradation
mtl00903  Limonene and pinene degradation
mtl01100  Metabolic pathways
mtl01110  Biosynthesis of secondary metabolites
mtl01120  Microbial metabolism in diverse environments
mtl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mtl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CCDC5180_3002
   00053 Ascorbate and aldarate metabolism
    CCDC5180_3002
   00620 Pyruvate metabolism
    CCDC5180_3002
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CCDC5180_3002
   00561 Glycerolipid metabolism
    CCDC5180_3002
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCDC5180_3002
   00310 Lysine degradation
    CCDC5180_3002
   00330 Arginine and proline metabolism
    CCDC5180_3002
   00340 Histidine metabolism
    CCDC5180_3002
   00380 Tryptophan metabolism
    CCDC5180_3002
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CCDC5180_3002
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CCDC5180_3002
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CCDC5180_3002
Enzymes [BR:mtl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CCDC5180_3002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AEJ51839
Position
3661193..3662677
Genome map
AA seq 494 aa AA seqDB search
MLEACQAIGVTAALGEPGEHSLPASTPITGDVLFSIAPTTPEQADHAIAAAAATFTAWRS
TPAPVRGALVARLGELLTAHQQDLATLVTVEVGKITAEARGEVQEMIDVCQFSVGLSRQL
YGRTIASERAGHRLLETWHPLGVVGVITAFNFPVAVWAWNTAVALVCGDTVVWKPSELTP
LTALASQALLSRAAADVGAPAAVGGLLLGGAERGAQLVDDPRVALLSATGSVRMGQQVGP
RVARRFGRVLLELGGNNAAIVAPSADLELAVRGIVFAAAGTAGQRCTSLRRLIVHRSVAD
DVVARVVGAYRQLAIGDPSAPDTLVGPLIHEAAYRDMVAALERARTDGGEVIGGDRREVG
SPGAYYVAPAVVRMPSQTAIVATETFAPILYVLTYDDLDEAIALNNAVPQGLSSSIFTTD
LREAEHFLDQSDCGIANVNIGTSGAEIGGAFGGEKQTGGGRESGSDAWKAYMRRATNTVN
YSSELPLAQGVKFG
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgaagcctgccaagcgatcggcgtaaccgccgcccttggcgagccgggcgaacac
agcctgcccgcgagcacaccgatcaccggcgacgtgctgttcagcatcgcaccgaccacc
ccggagcaggccgaccacgcgatcgccgcggcggccgcaacatttacggcatggcgaagc
acgccggccccggtgcgcggcgcgctcgtggcccggctcggcgagctgctcaccgcacac
cagcaggacctcgcgacactggtcacagtcgaagtaggcaagatcaccgccgaggcgcgc
ggcgaagtgcaggaaatgatcgacgtctgccagttctcggtgggtctgtcacgccagctc
tacggccgcaccatcgcgtcagagcgcgctgggcaccggctcctggaaacctggcatccg
ctgggagtggtgggcgtgatcaccgcgttcaacttcccggtcgcggtctgggcgtggaac
accgcggtggcactggtctgcggcgacacggtggtgtggaaaccctcggagctgacgccg
ttgacggcgctggccagccaggcgctgctcagtcgggccgccgctgatgtcggcgcgccg
gccgcggtgggcggcctgctgttgggcggcgccgagcgtggtgcgcaactcgtcgacgac
ccgcgggttgcgttgttgtcggcgacgggttcggtgcggatgggccagcaggtcggtcca
cgcgtcgcccggcgcttcgggcgggtgctgctggagttgggcggcaacaacgcggccatt
gtggcgccgtcggccgacctggagctggcggtgcgcggcatcgtgttcgccgcggccggc
accgcaggtcagcgctgcaccagcctgcgccggctgatcgtgcaccgctcggtggctgac
gatgtggtggcacgcgtcgtcggcgcctatcgccagctggcgatcggtgacccgtcggcc
ccggacacgctggtaggcccactcatccacgaggccgcctaccgcgacatggtggcagcg
ctcgagcgggcacgcaccgacggcggcgaggtcatcggcggtgatcgtcgcgaggtgggc
tcaccgggcgcctactatgtcgcgcccgctgtggtccgaatgccgtcccagaccgccatc
gtggcgaccgaaacgttcgcaccaatcctgtacgtgctcacctacgacgacctcgacgag
gcgatagccctcaacaacgcggtaccacaagggctttcgtcgtcgatcttcacgaccgac
ctgcgtgaggccgagcacttcctcgaccagtccgactgcggtatcgccaacgtcaacatc
gggacgtcgggagcggagatcggtggtgccttcggcggcgagaagcagaccggcggcggc
cgcgagtccgggtccgacgcgtggaaggcctacatgcgccgggccaccaacaccgtcaac
tactcgagcgagctgccgctggcgcagggcgtgaagttcgggtaa

DBGET integrated database retrieval system