KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_3228Help
Entry
CCDC5180_3228     CDS       T01992                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Pathway
mtl00360  Phenylalanine metabolism
mtl00362  Benzoate degradation
mtl00620  Pyruvate metabolism
mtl00621  Dioxin degradation
mtl00622  Xylene degradation
mtl00650  Butanoate metabolism
mtl01100  Metabolic pathways
mtl01120  Microbial metabolism in diverse environments
mtl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mtl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CCDC5180_3228
   00650 Butanoate metabolism
    CCDC5180_3228
  Amino acid metabolism
   00360 Phenylalanine metabolism
    CCDC5180_3228
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCDC5180_3228
   00622 Xylene degradation
    CCDC5180_3228
   00621 Dioxin degradation
    CCDC5180_3228
Enzymes [BR:mtl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CCDC5180_3228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AEJ52065
Structure
PDB: 

Position
complement(3967394..3968305)
Genome map
AA seq 303 aa AA seqDB search
MPSKAKVAIVGSGNISTDLLYKLLRSEWLEPRWMVGIDPESDGLARAAKLGLETTHEGVD
WLLAQPDKPDLVFEATSAYVHRDAAPKYAEAGIRAIDLTPAAVGPAVIPPANLREHLDAP
NVNMITCGGQATIPIVYAVSRIVEVPYAEIVASVASVSAGPGTRANIDEFTKTTARGVQT
IGGAARGKAIIILNPADPPMIMRDTIFCAIPTDADREAIAASIHDVVKEVQTYVPGYRLL
NEPQFDEPSINSGGQALVTTFVEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKETLVVG
GAR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccaaggcaaaagtggcgattgtcgggtcgggaaatatcagcaccgatctgctg
tacaagctgctgcgatcggagtggctggagccgcgctggatggtgggcatcgacccggag
agcgatggcctggcgcgcgcggccaagctgggtttggagaccacccacgagggggtggac
tggctgctggcgcagcccgataaacccgacctggtgttcgaggcaaccagtgcctacgtg
caccgggacgcggcgcccaagtacgccgaggccgggatccgggccatcgacctgacgccg
gcggcggtgggtccggcggtgatcccgccggcgaacctgcgcgagcacctggacgcgccg
aacgtcaacatgatcacctgcgggggacaggcgaccattccgatcgtgtacgcggtgtct
cggatcgtggaggtgccctacgccgagatcgtggcgtcggtggcttccgtttcagcggga
ccgggcacgcgcgccaacatcgacgagttcaccaagaccaccgcccgtggggtccagacc
atcggcggggccgcccgcggcaaggcgatcatcatcttgaatcccgccgacccgccgatg
atcatgcgcgacaccatcttttgcgccatccccaccgacgccgaccgcgaagcgatcgcc
gcctccatccacgacgtcgtcaaagaggtgcagacctacgtgcctggataccggctgctc
aacgaaccgcagttcgacgagccgtcgatcaactcgggcgggcaggcgctggtcaccacg
ttcgtcgaggttgagggcgccggggattacctgccgccctatgcgggcaacctggacatc
atgaccgcggcggccaccaaggtgggcgaggagatcgccaaggagacgctggttgtagga
ggagcgcgatga

DBGET integrated database retrieval system