KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_3262Help
Entry
CCDC5180_3262     CDS       T01992                                 

Definition
(GenBank) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase BphD
  KO
K16050  4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase [EC:3.7.1.17]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Pathway
mtl00984  Steroid degradation
mtl01100  Metabolic pathways
mtl01120  Microbial metabolism in diverse environments
mtl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mtl00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    CCDC5180_3262
Enzymes [BR:mtl01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.17  4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase
     CCDC5180_3262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr
Motif
Other DBs
NCBI-ProteinID: AEJ52099
Structure
PDB: 

Position
complement(4004000..4004875)
Genome map
AA seq 291 aa AA seqDB search
MTATEELTFESTSRFAEVDVDGPLKLHYHEAGVGNDQTVVLLHGGGPGAASWTNFSRNIA
VLARHFHVLAVDQPGYGHSDKRAEHGQFNRYAAMALKGLFDQLGLGRVPLVGNSLGGGTA
VRFALDYPARAGRLVLMGPGGLSINLFAPDPTEGVKRLSKFSVAPTRENLEAFLRVMVYD
KNLITPELVDQRFALASTPESLTATRAMGKSFAGADFEAGMMWREVYRLRQPVLLIWGRE
DRVNPLDGALVALKTIPRAQLHVFGQCGHWVQVEKFDEFNKLTIEFLGGGR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgacagctaccgaggaattgacgttcgaatccacctcgcgctttgcggaagtggacgtc
gacgggccgctgaaactgcactaccacgaggccggcgtgggcaacgaccagacggtggtg
ctactgcacggcggtgggcccggcgcggcgagctggacgaacttctcgcgtaatatcgcg
gtgctggcgcggcactttcatgtgctggccgtcgaccagcccggttacggccattccgac
aagcgggccgagcacggccagttcaatcgctatgccgcgatggcgctgaaggggctcttc
gatcagctggggctggggcgggtaccgctggtgggcaactcgttgggcgggggaaccgcg
gtccggtttgcgctggactacccggcccgggcaggacggttagtgctgatgggcccgggg
ggcctgagtatcaacctgtttgcgcccgacccgaccgagggagtcaaacggctgtcgaag
ttctccgttgcgcccacccgggagaacctcgaggcgttcctgcgggtcatggtctacgac
aagaacctgatcacccccgagttggtggatcagcggtttgcgctggccagcaccccggag
tcgttgacggcaacacgggcgatgggaaagtcgttcgccggagccgacttcgaggccggc
atgatgtggcgcgaggtgtatcggctgcgccagccggtgttgctgatctggggtcgtgag
gaccgggtcaacccgctggacggcgcgctggttgcgttgaaaacgattccgcgtgcgcag
ctgcacgtattcgggcagtgtgggcattgggtgcaggtggagaagttcgacgagttcaac
aagctgacgattgaatttctgggaggtggcagatga

DBGET integrated database retrieval system