KEGG   Thermothelomyces thermophilus: MYCTH_101588Help
Entry
MYCTH_101588      CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K18083  myotubularin-related protein 6/7/8 [EC:3.1.3.64 3.1.3.95]
Organism
mtm  Thermothelomyces thermophilus
Pathway
mtm00562  Inositol phosphate metabolism
mtm01100  Metabolic pathways
mtm04070  Phosphatidylinositol signaling system
mtm04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:mtm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    MYCTH_101588
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    MYCTH_101588
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    MYCTH_101588
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mtm01009]
    MYCTH_101588
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     MYCTH_101588
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     MYCTH_101588
Protein phosphatases and associated proteins [BR:mtm01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    MYCTH_101588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Myotub-related Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 11507805
NCBI-ProteinID: XP_003663179
JGI: 101588
UniProt: G2QBJ1
Position
3:complement(join(3005125..3005162,3005209..3007576,3007630..3007653))
Genome map
AA seq 809 aa AA seqDB search
MSVPQSKHVFRNVHALRGGKPELGDLALNDYHLVFQFPPESATTADPQLKKRVRQAWFAF
HVIGHCTLRLTAPASGVPSSIRIRFRDFTFVCFNFAEDKQAREAFEFIRARTCRLGSIEN
LLAFNYTPPPGSPENKINGWDLYDARAEFRRQGISEKSADLGWRITNINKDYTFSPTYPA
VLVVPSRISDNTLKYAAAFRSRARIPTLSYLHPVNNCTITRSSQPFVGLRGKRSIQDERL
VGACFSASMDSLDVALSANTDRSPSSSHVDLSAESADSDASLSETERMRMEDELIAGTNA
QYDEKTGKRLIYGAQQHNLIVDARPAINSYAMQAIGMGSENMDYYRFAKKVFLNIDNIHV
MRDSLEKVVNAIKDADISPLPPNRDLLAKSKWLKHISGILDGSAIIARQVGIQHSHVLIH
CSDGWDRTSQLSALAQLMLDPYYRTIDGFIVLVEKEWLSFGHMFQLRSGHMSHESWFTVD
SDALAGSTIRPGESEGRGDAIESAFASAKRLWNKSMGTEKDTPPPEAEESLAADDSKQGY
APITEDHATRPRDVSPVFHQFLDATYQLLRQHPTRFEFNERMLRRLLYHVYSCQYGTFLF
NNERQRREAKLHERTRSVWAYFLSRRQEFTNDQYDPTIDDHIKGRERLIFPRLGEVRWWY
QLFNRTDDEMNGDINASLATAERVAAYQAASGLSEPGVGGETASSQSETGSGDSASSSRS
LQPPGLTASQSVLAGVETAHEALTPEARATASLNRSASTAGMPGALGALQDRLSGLAIGK
GVFGSAMGSSSTGRNRPAGNRKRRTEGKR
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttccgcagagcaagcacgtcttccgcaacgtgcacgccttacgaggcgggaaa
cccgagctcggtgatctggcgctgaatgactaccatctcgttttccagtttcctcccgaa
tccgcgactaccgccgacccgcagttgaagaagcgggtcaggcaggcctggtttgctttt
catgtcataggccactgcacactgcggctgactgctcccgcgagcggtgtgccctcgtcg
atacgcatccgtttccgggatttcacctttgtgtgtttcaattttgccgaggacaaacag
gcccgggaggccttcgagttcatccgcgcgaggacgtgcaggctggggagcatagagaac
cttctggccttcaactacactccgccgccaggttctcccgagaacaagatcaacggttgg
gatctgtacgatgcgagggccgaattcaggcggcagggtatcagcgagaagtcagcggac
cttgggtggaggataaccaacatcaacaaggactataccttctccccgacctacccggcc
gtattagtggtgccgtccagaatctcggataacacgctcaagtacgctgccgcgtttcgc
tcccgcgcccggataccgacgctcagttacctccatcccgtcaataactgcaccataacc
cgcagttcgcagccgttcgtggggcttcgggggaagcgcagcatccaagatgagcgcctc
gtcggggcttgcttttctgcctctatggactctctcgatgtcgctctttccgccaacacg
gaccgcagcccgtcgtccagccacgtggatctgagcgccgagagcgcggattctgacgcg
tcgttgtcagaaacggagcggatgcggatggaggacgagctcattgctggcaccaacgcg
cagtacgacgaaaagacgggcaagcgactgatatacggtgcgcagcaacacaacctcatc
gtcgacgcccggcctgcgatcaactcgtatgccatgcaggcgatagggatggggtcggag
aacatggactactacagatttgccaagaaggttttcctaaatatagacaatattcacgtc
atgagggattccctggaaaaggtcgtcaacgctatcaaggacgccgacatttcacccttg
ccccccaaccgagacctcctggccaaaagcaaatggctgaagcacattagcggcatcctg
gacggctcggctatcatcgcgcggcaggttggcatccagcattcccatgtgctcatccac
tgctcggacggctgggaccggacgagccagctgagcgccctggcccagctgatgcttgac
ccctattatcgcaccatcgacggtttcattgtcttggtcgagaaggaatggctctcgttt
gggcacatgttccaattgcggtccggccacatgagtcacgagagctggttcaccgtggat
agcgacgcgttggccggctcaacgatccgacccggcgagagcgagggtcggggagacgct
atcgagagcgcttttgcaagcgcaaagcggctgtggaacaagagtatgggtaccgagaaa
gatacgccccccccagaagcggaggaatctttggcggcggacgactcgaagcagggttac
gctcccattaccgaagatcacgccacgaggcccagggacgtgtcgcccgtctttcaccag
ttcctcgacgccacgtaccagctcctgcggcaacacccgacgcggtttgaatttaatgaa
cgcatgcttcggcgcttactctatcacgtgtactcgtgccaatacggcacctttctgttc
aacaacgagcggcagcgccgcgaggcgaagctgcatgagcgcactcgcagcgtatgggct
tactttttaagtcgccgccaggagttcactaacgaccaatatgacccgactatcgatgat
cacataaaaggccgggagcggctcatcttcccgcggctgggcgaggtgcgatggtggtat
cagcttttcaatcgcaccgacgacgagatgaacggcgacatcaatgcttctctcgccaca
gcagagcgcgttgcagcctatcaggccgcatcggggctgtcagagcctggtgttggtggt
gaaaccgcaagcagccagtccgagaccgggtctggggactccgccagttcgtctcgcagc
ttgcaacctccgggattgacggcgagccagtccgttctcgcgggtgtcgagactgctcat
gaggctctaacgccggaagctagggcgaccgcgtcgttgaatcgcagcgctagtacagcc
gggatgcctggtgccctcggagccctacaggataggctttccgggctggctattgggaag
ggtgtctttggaagtgctatgggaagttccagcacgggaaggaatcgaccggccggaaac
cgaaagaggaggacggagggcaagagatga

DBGET integrated database retrieval system