KEGG   Thermothelomyces thermophila: MYCTH_103702Help
Entry
MYCTH_103702      CDS       T02231                                 

Definition
(RefSeq) aldose epimerase-like protein
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
mtm  Thermothelomyces thermophila
Pathway
mtm00010  Glycolysis / Gluconeogenesis
mtm00052  Galactose metabolism
mtm01100  Metabolic pathways
mtm01110  Biosynthesis of secondary metabolites
mtm01130  Biosynthesis of antibiotics
Module
mtm_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYCTH_103702
   00052 Galactose metabolism
    MYCTH_103702
Enzymes [BR:mtm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     MYCTH_103702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 11506727
NCBI-ProteinID: XP_003664855
JGI: 103702
UniProt: G2QJ35
Position
5:join(753434..753532,753662..753761,753836..754162,754329..754845,754950..755043)
Genome map
AA seq 378 aa AA seqDB search
MAAEASVIGRERHVPPPGEDGRYTISAEGIKAQFIPYGATLTNLFVKDKNGEDIDVVLGY
DDVNYYPEDPGHPVYNAIPGRYANRIGNGKYTLDGKTYFTEKNDGNNTLHSGTNNWSYRV
WDVTDLKEDSITFSILDKANSSQGFPGDVKASVTYSVKGSTWNIKMKAEALNHKTPLLLT
QHTYFNLDAYHNPDTAKIWDHGLYLPYSKRYLEGDQGALPTGKILTAEPGSINDFASSAD
LTVGHARDQPGFEGNCGADGACEGYNGYFLIEDKPSADAVVLRLSSAFSGVTADLRTDQP
GVVLYSCNWMDGSADLKSTQGIKGVNEKVIRSSCIAIEAQDYPDGINHPEWGRTEAQIWG
PGETYTWESSWTFGLLEA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgaagcgtccgtgatcggcagagaacgtcacgtcccgccgcctggcgaggat
gggcgctacaccatatctgcggagggtatcaaggcgcagttcatcccgtacggcgccacc
ctgaccaacttgttcgtcaaggacaagaacggcgaggacattgacgtggtgctcggctac
gacgatgtcaactattaccccgaggaccccggccatccggtgtacaacgccattcccggc
cggtacgccaaccggatcggcaacgggaagtacactctcgacgggaagacgtacttcacc
gagaagaacgacggcaacaacacgctgcacagcggcaccaacaactggtcgtaccgcgtg
tgggacgtgaccgatctcaaggaggactccatcaccttctcgatcctggacaaggccaat
tcgtcccagggcttcccgggcgacgttaaagcgtccgtcacgtactcggtcaagggttcg
acctggaacatcaagatgaaggccgaggctctgaaccacaagacccccctcctgctcact
cagcacacctacttcaacctggacgcctaccacaacccagacacggccaagatctgggac
cacgggctgtacctgccgtactcgaagcggtacctcgagggcgaccagggggcgctgccg
acgggcaagatcctgactgcggagcccgggtcgatcaacgacttcgcgtcgtcggcggac
ctgacggtcgggcacgcgcgggaccagcccgggttcgagggcaactgcggggccgacggc
gcctgcgagggctacaacggctacttcctgatcgaggacaagccgtccgccgacgccgtc
gtcctccgcctgtcgagcgccttctcgggcgtcaccgccgacctgcgcaccgaccagccc
ggcgtcgtcctctactcgtgcaactggatggacggctccgccgacctcaagagcacccag
ggcatcaagggcgtcaacgagaaggtcatcaggagcagctgcatcgccatcgaagcccag
gactacccggatggcatcaaccatcctgaatggggacgtaccgaagcgcagatctggggc
ccgggtgagacgtacacgtgggagagctcgtggacctttgggttgctcgaagcctga

DBGET integrated database retrieval system