KEGG   Thermothelomyces thermophila: MYCTH_110871Help
Entry
MYCTH_110871      CDS       T02231                                 

Definition
(RefSeq) isocitrate lyase-like protein
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
mtm  Thermothelomyces thermophila
Pathway
mtm00630  Glyoxylate and dicarboxylate metabolism
mtm01100  Metabolic pathways
mtm01110  Biosynthesis of secondary metabolites
mtm01200  Carbon metabolism
Module
mtm_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MYCTH_110871
Enzymes [BR:mtm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     MYCTH_110871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-GeneID: 11512259
NCBI-ProteinID: XP_003662206
JGI: 110871
UniProt: G2Q804
Position
2:join(4664541..4664771,4664897..4665052,4665150..4665492,4665643..4666195,4666315..4666672)
Genome map
AA seq 546 aa AA seqDB search
MAANNMINPAVDPNLEDELFAKEVEEVKRWWSEPRWRYTKRPFTAEQIVNKRGNLKIEYA
SNTQSKKLWNILEKRFKERDASYTYGCLEPTAVTQMAKYLDTVYVSGWQSSSTASSSDEP
GPDLADYPYTTVPNKVGHLFMAQLFHDRKQRQERMSVPKAQRAKLPNIDYLRPIIADADT
GHGGLTAVMKLTKLFIEKGAAGIHIEDQAPGTKKCGHMAGKVLVPISEHINRLVAIRAQA
DIMGSDLIAIARTDAEAATLITSTIDPRDHAFILGSTNPNLQPLNDLMLAAERAGKAGAE
LQAIEDKWLEQANLKRFDDAVLDAIAGMPNAQSLADQYRSAIKGKQLSNAEARAIARRIL
GRDIYFDWDAPRTREGYYRLKGGCDCSINRAIAYAPYCDAIWMESKLPDYKQAEEFARGV
HAVWPEQKLAYNLSPSFNWKAAMPREEQETYIRRLAKLGYCWQFITLAGLHTTALISDRF
AQAYARQGMRAYGELVQEPEMELGVDVVKHQKWSGAAYVDELQKMVTGGVSSTAAMGKGV
TEEQFH
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggccgccaataacatgatcaatcccgccgtggatcccaacctggaggacgaactcttc
gccaaggaggtcgaggaggtcaagaggtggtggagcgagccacgatggcggtacacgaag
cggccctttaccgcggagcagattgtcaacaagcgcggcaatctcaagattgagtacgcc
agcaacacacagagcaagaagttgtggaacatcctcgagaagcgtttcaaggaaagggac
gccagctacacgtacggctgcctggagcccactgccgtcacccagatggccaagtacctc
gacaccgtctacgtctcgggctggcagtcgtcatcgaccgcctcctcctcggacgagccc
ggtccggacctggctgactacccctacacgacggtgcccaacaaggtcggccatctcttc
atggcgcagctcttccacgaccgcaagcagcgccaggagcgcatgtcggtgcccaaggcc
cagcgcgccaagcttcccaacatcgactacctgcgccccatcatcgccgacgctgacacg
ggccatggcggtctgaccgccgtcatgaagctgaccaagctcttcattgagaagggcgcc
gccggcatccacatcgaggaccaggcgccgggcaccaagaagtgcggccacatggccggc
aaggtcctggtgcccattagcgagcacatcaaccgcctggtggccatccgcgcccaggcc
gacattatgggctccgacctcattgccatcgcgcggaccgacgccgaggcggccacgctc
atcacgtccaccatcgacccgcgcgaccacgccttcatcctgggcagcaccaaccccaac
ctgcagccgctcaacgacctgatgctggcggccgagagggccggcaaggcgggcgctgag
ctgcaggccatcgaggacaagtggctggagcaggccaacctcaagcgcttcgacgacgcc
gtgctggacgccatcgccggcatgcccaacgcgcagtcgctggccgaccagtaccgcagc
gccatcaagggcaagcagctgtccaacgccgaggcccgcgccatcgcccgccgcatcctc
ggccgcgacatttactttgactgggacgccccgcgcacccgcgagggctactaccgcctc
aagggcggctgcgactgctccatcaaccgcgccatcgcctatgccccttactgcgacgcc
atctggatggagagcaagctgcccgactacaagcaggcagaggaatttgcccgcggcgtg
cacgccgtctggcccgagcaaaaactcgcgtacaacctgtcgccctcgttcaactggaag
gcggcgatgccgcgggaggagcaggagacgtacatccggcggctggccaagctgggctac
tgctggcagttcatcacgctggcgggcctgcacacgacggcgctgatcagcgaccggttc
gcgcaggcctacgcgcgccagggcatgcgcgcctacggcgagctcgtccaggagcccgag
atggagctcggcgtcgacgtggtcaagcaccagaagtggagcggcgccgcctacgtcgac
gagctgcagaagatggtcaccggcggcgtcagctccaccgccgccatgggcaagggcgtc
accgaggagcagttccattaa

DBGET integrated database retrieval system