KEGG   Thermothelomyces thermophilus: MYCTH_112121Help
Entry
MYCTH_112121      CDS       T02231                                 

Definition
(RefSeq) pyruvate decarboxylase-like protein
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
mtm  Thermothelomyces thermophilus
Pathway
mtm00010  Glycolysis / Gluconeogenesis
mtm01100  Metabolic pathways
mtm01110  Biosynthesis of secondary metabolites
mtm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mtm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYCTH_112121
Enzymes [BR:mtm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     MYCTH_112121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C
Motif
Other DBs
NCBI-GeneID: 11511210
NCBI-ProteinID: XP_003665450
JGI: 112121
UniProt: G2QI16
Position
5:join(3335131..3335314,3335384..3336617,3336667..3336973)
Genome map
AA seq 574 aa AA seqDB search
MTDIREQGLKKPVNVAEYLFRRLHEIGIRSVHGLPGDFNLVALDYIPKAGLKWVGSVNEL
NAAYAADGYARTKGISAIFTTFGVGELSAINGIAGAFSEHVPVVHIVGCPSTISQRNGML
LHHTLGNGDFNVFANMSSQISCDVARLNKRAEIADQIDHALRECWIRSRPVYIMLPTDMV
ERKVEGARLDTPIDLTEPANQSEREDYVVDVVLRYLHAAKQPVILVDACAIRHRVLKEVH
DLVEKTQLPVFVTPMGKGAINEDHPNYGGVYAGTGSQPAVAERVETADLVLSIGALKSDF
NTAGFSYRTSQLNTIDFHSDHCTVRYSEYPGVAMRGVLRKVVERVDLSKLSRPPSPEVVN
EVTKNRDSSQTITQAFFWPRIGEYLKENDIVVTETGTSNFGIWETKYPRGVTGITQILWG
SIGWSVGAAQGAALAAKDMGVDRRTILFVGDGSFQLTAQEVSTMIRHDLRITIFLIFNGG
FTIERFIHGMEAEYNDITRWNYIDVPTAFGGSEKQVRKFVVKTKDELEELLTDTDFNEAR
GLQFVELWMRKDDAPRALKITAEIAARNNASMSE
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgacagacatcagagagcagggccttaagaaacccgtcaacgtcgccgagtatctgttc
aggagactccacgaaatcggcatccgctccgttcatggcctcccaggtgacttcaacctg
gttgcattggactacattcccaaagctggcctcaaatgggtgggcagcgtgaatgagctg
aatgcagcatacgctgccgacgggtatgcccgcacaaagggcatctcagctatttttact
acctttggagtgggagagttatctgcaatcaacggtatcgccggcgccttctccgaacac
gttcccgtagtacacattgttggctgcccgtcgacgatttcacaacggaatggcatgctg
cttcaccacacgcttggcaatggagactttaacgttttcgccaacatgagctctcagatc
tcttgcgatgtggctcgtctcaataaacgggccgagatagccgaccagatcgaccatgcc
ctgcgcgagtgctggatccgcagtcggcccgtatacatcatgcttccgacagacatggtc
gagaggaaggttgagggcgcccgtctggacacgcccattgacctcacagaacccgccaac
cagtcagagcgggaggactatgtcgttgacgtcgtcctgaggtatctccacgcggctaag
caacctgtaattttggtcgatgcctgcgccattcgccatagggtgctcaaggaggttcat
gacttggtggagaaaacccagctgccggtattcgttaccccaatgggcaagggcgccatc
aacgaggaccatcccaactatggcggagtatatgcgggaactggttcgcagcccgcggtg
gctgagcgtgttgagacagcggacctggtgctttcgatcggcgccctcaagagcgacttc
aacacggcaggcttttcgtaccggacgtcccaactcaacacgatcgacttccactcggac
cattgcacggtgcggtattccgagtaccccggcgtggccatgcgcggcgtgctccgcaag
gtggtggaacgggttgatcttagcaaactgtctaggcctccatcgcccgaggtggtcaac
gaggtgactaagaacagggatagttcccaaaccatcacacaggcgttcttctggccacgc
attggggaatatctgaaggagaacgacatcgtggtgacagaaacgggcacgtccaacttc
ggcatttgggaaaccaagtacccacggggtgtgactgggatcacacaaattctttggggc
agcattggttggtcggtgggcgccgcccaaggtgccgcgctagctgcaaaggacatgggc
gtcgaccgccgaaccatcttgtttgtcggcgacggctcgttccagctcacggcccaagag
gtgtcaaccatgatccgacatgatttgaggatcaccatattcctgattttcaacggcggc
ttcaccatcgagcgctttatccatggcatggaggccgagtacaatgatatcacccgttgg
aactacattgacgtgccaacagcattcggcggttcggaaaaacaggttcgcaagtttgtc
gtcaagaccaaggatgagctcgaggagctattgacggacacagacttcaatgaggctaga
gggttacagtttgttgagctgtggatgcgaaaggatgacgcaccgcgggccctgaagatc
actgctgagattgccgctagaaacaacgcaagtatgagtgagtaa

DBGET integrated database retrieval system