KEGG   Thermothelomyces thermophilus: MYCTH_112686Help
Entry
MYCTH_112686      CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mtm  Thermothelomyces thermophilus
Pathway
mtm03040  Spliceosome
mtm04141  Protein processing in endoplasmic reticulum
mtm04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mtm00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    MYCTH_112686
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    MYCTH_112686
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    MYCTH_112686
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mtm01009]
    MYCTH_112686
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mtm03041]
    MYCTH_112686
   03009 Ribosome biogenesis [BR:mtm03009]
    MYCTH_112686
   03110 Chaperones and folding catalysts [BR:mtm03110]
    MYCTH_112686
   04131 Membrane trafficking [BR:mtm04131]
    MYCTH_112686
   03051 Proteasome [BR:mtm03051]
    MYCTH_112686
   03029 Mitochondrial biogenesis [BR:mtm03029]
    MYCTH_112686
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtm04147]
    MYCTH_112686
Protein phosphatases and associated proteins [BR:mtm01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     MYCTH_112686
Spliceosome [BR:mtm03041]
 Complex B
  Other components
   Prp19 complex
    MYCTH_112686
 Complex C
   Prp19-CDC5 complex
    MYCTH_112686
Ribosome biogenesis [BR:mtm03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    MYCTH_112686
Chaperones and folding catalysts [BR:mtm03110]
 Heat shock proteins
  HSP70 / DNAK
   MYCTH_112686
Membrane trafficking [BR:mtm04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    MYCTH_112686
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    MYCTH_112686
Proteasome [BR:mtm03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    MYCTH_112686
Mitochondrial biogenesis [BR:mtm03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    MYCTH_112686
Exosome [BR:mtm04147]
 Exosomal proteins
  Proteins found in most exosomes
   MYCTH_112686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 11506538
NCBI-ProteinID: XP_003666565
JGI: 112686
UniProt: G2QNZ9
Position
7:complement(join(490272..491469,491764..492444,492667..492734))
Genome map
AA seq 648 aa AA seqDB search
MAPAVGIDLGTTYSCVGVFREDRCEIIANDQGNRTTPSFVAFTDTERLIGDAAKNQVAMN
PHNTVFDAKRLIGRKFTDPEVQADMKHFPFKVIERNGKPVIEVEFKGETKVFTPEEISSM
VLTKMRETAESYLGGTVTNAVITVPAYFNDSQRQATKDAGLIAGLNVLRIINEPTAAAIA
YGLDKKADGERNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFDNRLVNHFI
AEFKRKHRKDLSTNARALRRLRTACERAKRTLSSSAQTSIEIDSLYEGIDFYTSITRARF
EELCQDLFRSTLQPVDRVLTDAKIDKSQVHEIVLVGGSTRIPRIQKLISDYFNGKEPNKS
INPDEAVAYGAAVQAAILSGDTTSKSTNEILLLDVAPLSLGIETAGGMMTKLIPRNTTIP
TKKSEVFSTFSDNQPGVLIQVYEGERQRTKDNNLLGKFELTGIPPAPRGVPQIEVTFDLD
ANGIMNVSALEKGTGKTNKIVITNDKGRLSKEEIERMLAEAEKFKAEDEAEAARVSAKNA
LESYAYSLRNTLNDSKVDEKLDASEKEKLKSEIDKIVSWLDDNQQATREEYEEHQKELES
IANPIMMKFYGAGAGGMPGGMPGAAPGGFPGAGGASNDNDGPTVEEVD
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggctcccgccgtcggtattgatttgggcacgacctactcgtgcgtgggtgttttccgt
gaggaccggtgcgaaatcatcgccaatgaccagggcaaccggacaactccgtccttcgtc
gccttcacagacaccgagcgcctcatcggtgatgctgccaagaaccaggtcgccatgaac
cctcacaacaccgtctttgacgccaagcgcctgattggtcgcaagttcaccgaccccgag
gttcaggccgatatgaagcacttccccttcaaggtcattgagcgcaatggcaagcccgtc
atcgaggtcgagttcaagggcgagaccaaggtcttcacccccgaggagatctcctccatg
gtcctgaccaagatgcgcgagactgccgagtcctacctcggtggcaccgtcaccaacgct
gtcatcaccgtccccgcctacttcaacgacagccagaggcaggccaccaaggacgccggt
ctcattgccggcctcaacgtcctccgcatcatcaacgagcccactgctgccgccattgcc
tacggtctcgacaagaaggccgatggtgagcgcaacgtcctcatcttcgatcttggcggc
ggtaccttcgatgtctccctcctcaccatcgaggagggtatcttcgaggtcaagtccact
gccggcgacacccacctgggtggtgaggacttcgacaaccgtctcgtgaatcatttcata
gctgagttcaaaaggaaacaccgcaaagatctctccaccaacgcccgtgcgctgcggcgt
ctccgcaccgcttgcgagcgtgccaagcgcactctctcgtcgtctgcccagacctcgatt
gagatcgactctctctacgagggtatcgacttctacacgtccatcacccgtgctcgcttc
gaggagctgtgccaggacctcttccgctcgactctccagcccgttgaccgtgtcctgacg
gatgccaagatcgacaagtctcaggtccacgagatcgtgctcgttggtggctcgactcgt
atccctcgcatccagaagctgatcagcgactacttcaacggcaaggagcccaacaagtcg
atcaaccctgatgaggctgttgcctacggtgccgccgttcaggccgccattctctctggc
gacaccacgtccaagtcgaccaacgagattctcctgctcgatgtcgctccgctgtcgctc
ggtatcgagactgctggtggcatgatgaccaagcttatcccccgcaacaccaccatcccc
accaagaagtccgaggtcttctcgaccttctccgacaaccagcccggtgtgctcatccag
gtctatgagggcgagcgccagcgcaccaaggacaacaacctgctgggcaagttcgagctt
actggcattccgcccgcccctcgtggtgttccccagatcgaggttaccttcgaccttgat
gccaacggtatcatgaacgtctccgctctggagaagggcaccggcaagacgaacaagatc
gtcattaccaacgacaagggccgcctgtcgaaggaggagatcgagcgcatgcttgccgag
gccgagaagttcaaggcggaggatgaggccgaggctgcccgtgtctctgccaagaacgcc
cttgagtcgtacgcctactcgctgcgcaacactctcaacgactccaaggttgatgagaag
ctcgacgcgtctgagaaggagaagctcaagtccgagatcgacaagatcgtttcctggctc
gacgacaaccagcaggccactcgcgaggagtatgaggagcaccagaaggagcttgagagc
atcgccaatcccatcatgatgaagttctacggtgctggcgctggcggcatgcccggcggc
atgcccggtgccgctcctggtggcttccccggcgctggtggtgctagcaacgacaacgac
ggccctaccgttgaggaggttgactaa

DBGET integrated database retrieval system