KEGG   Thermothelomyces thermophilus: MYCTH_112996Help
Entry
MYCTH_112996      CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
mtm  Thermothelomyces thermophilus
Pathway
mtm00350  Tyrosine metabolism
mtm00360  Phenylalanine metabolism
mtm00380  Tryptophan metabolism
mtm01100  Metabolic pathways
mtm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    MYCTH_112996
   00360 Phenylalanine metabolism
    MYCTH_112996
   00380 Tryptophan metabolism
    MYCTH_112996
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    MYCTH_112996
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtm04147]
    MYCTH_112996
Enzymes [BR:mtm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     MYCTH_112996
    4.1.1.105  L-tryptophan decarboxylase
     MYCTH_112996
Exosome [BR:mtm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MYCTH_112996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 11508861
NCBI-ProteinID: XP_003660604
JGI: 112996
UniProt: G2Q4S0
Position
1:complement(join(9112182..9113671,9113784..9113832))
Genome map
AA seq 512 aa AA seqDB search
MDSREFKEAATSSIDEIINYFETLGSRNVVSTVEPGYLRKLLPSEAPEEGEPWSAIRADV
EAKIMPGITHWTHPGFHAFFPCATSYPSMLGELYSSALSGACFNWICSPAVTELETIVLD
WLARALGLPACYLSTGPTRGGGVIQGSASEAVLTAMVAARDKYLRETVPESGLAEEEREE
RVMVKRSRMVALATTLTHSSARKAALILGVRFRAIPVREEDGYRLRKEALAAALAECRAQ
GLEPFFLVATMGTTDVCSVDDFEGISEALAEHVAPDQPGEVWVHVDAAYAGAALVCPEVR
QSARIDLIERFHSFDMNMHKWLLVNFDASCFFVRNRDWLTKALSVNQAVYGNKASDGGLV
TDYREWQIPLGRRFRSLKIWFVMRSYGIKGMQQHIRRTSQLGEEFAAALRARPDLFEIVT
GPSFALTVFRVAAKSGEEPTPEEERNALTKALYERANASGKIWLTSTNLDGKFAIRLMTG
VRTTERQHVETAVKLLTEIAQEVITGKPVYLN
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggactcgagggaattcaaagaggcggcgacctcctccatcgacgagatcatcaactac
ttcgagaccctcgggtcgcgcaatgtcgtgtcgaccgtcgagccgggctacctccgcaag
ctgctgcccagcgaggcgcccgaggagggcgagccgtggtccgccatccgtgccgacgtc
gaggccaagatcatgcccggcatcacccactggacccatcccggcttccacgccttcttc
ccctgcgcaacctcgtacccgtccatgctgggcgagctctactcgtccgccctgtccggc
gcctgcttcaactggatctgctcccccgccgtcaccgaactcgagaccatcgtgctcgac
tggctcgcccgcgccctcggcctgcccgcctgctacctctccaccggcccgacccgcggc
ggcggcgtcatccagggctccgcctccgaggccgtcctgaccgccatggtcgccgcccgc
gacaagtacctgcgcgagacggtgcccgagtccggcctcgccgaggaggagagggaggag
cgcgtcatggtcaagcgctcccgcatggtcgccctcgccaccaccctgacccactcgagc
gcccgcaaggccgccctgatcctcggcgtccgcttccgcgccatccccgtccgggaggaa
gacggctacaggctgcggaaggaggccctggccgccgccctggccgagtgccgcgcccag
gggctcgagcccttcttcctggtcgccaccatgggcaccaccgacgtctgctccgtcgac
gacttcgagggcatcagcgaggccctggccgagcacgtggcccccgaccagcccggcgag
gtctgggtccacgtcgacgccgcctacgccggcgccgccctcgtctgcccggaggtccgg
cagtcggcccgcatcgacctgatcgagcgcttccacagcttcgacatgaacatgcacaag
tggctgctcgtcaacttcgacgccagctgcttcttcgttcgcaaccgcgactggctgacc
aaggccctgagcgtgaaccaggccgtctacggcaacaaggcctccgacggcggcctggtc
accgactaccgcgagtggcagatccccctgggccgccgcttccggagcctgaagatctgg
ttcgtcatgaggtcctacggcatcaaggggatgcagcagcacatccgccggacctcgcag
ctgggcgaggagtttgccgccgcgctgcgggccaggcccgacctgttcgagatcgtcacc
gggcccagcttcgccctgaccgtcttccgcgtggccgccaagtcgggagaagagcccacg
ccggaggaggagcggaacgcgctgaccaaggccctgtacgagagggccaacgcctcgggc
aagatctggctgacgagcaccaacctggacggcaagttcgccatccggctgatgacgggc
gtgaggacgactgagaggcagcacgtcgagacggccgtcaagctgctgaccgagatcgcc
caggaagtgataaccgggaagcctgtatacttgaactag

DBGET integrated database retrieval system