KEGG   Thermothelomyces thermophila: MYCTH_2082917Help
Entry
MYCTH_2082917     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mtm  Thermothelomyces thermophila
Pathway
mtm00020  Citrate cycle (TCA cycle)
mtm00310  Lysine degradation
mtm01100  Metabolic pathways
mtm01110  Biosynthesis of secondary metabolites
mtm01130  Biosynthesis of antibiotics
mtm01200  Carbon metabolism
Module
mtm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mtm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MYCTH_2082917
  Amino acid metabolism
   00310 Lysine degradation
    MYCTH_2082917
Enzymes [BR:mtm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MYCTH_2082917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 DUF3614 Hamartin Ndc1_Nup
Motif
Other DBs
NCBI-GeneID: 11511178
NCBI-ProteinID: XP_003665418
JGI: 2082917
UniProt: G2QHY4
Position
5:complement(join(3251943..3252239,3252298..3252690,3252751..3253119,3253182..3253424))
Genome map
AA seq 433 aa AA seqDB search
MLYRGLRLAARTAPRFSLSSTSSALRQLPLQFQHVRTYADTIVKVPTMAESISEGTLKQW
NKSIGDFVEQDEEIATIETDKIDVAVNAPEAGIIKEFLANEEDTVTVGQDLVRIELGGAP
SGDKPAATEAKETPKETPKETPKEPAPEKQTEQKNAPEPKPQETKPATPSAPAKEESAAP
KQPAKPAKATTEAPATLGSREERRVKMNRMRLRIAERLKQSQNTAASLTTFNEVDMSALI
EFRNKYKDEVLKKTGVKLGFMSAFSRACVLAMRDIPVVNASIEGPNGGDTIVYRDYVDIS
VAVATEKGLVTPVVRNVETMDMIEIEKAIAEMGKKARDGKLTIEDMAGGTFTISNGGVFG
SLMGTPIINLPQSAVLGLHAIKDRPVAVNGKVEIRPMMYLALTYDHRLLDGREAVQFLVK
VKEYIEDPRKMLL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgctctaccgaggacttcggctcgcggctcgtaccgctcctagattttcgctctccagc
acgagctcagcactacgccaactccctctgcaatttcagcatgtacggacctacgccgat
acgattgtcaaggtgccgacgatggccgagtcgatcagcgagggcaccttgaaacagtgg
aacaagtctattggcgactttgttgagcaggatgaggagattgcaacgattgaaacggac
aagatcgatgttgccgtgaacgcaccagaagccggcatcattaaagagttcttggccaat
gaggaagacactgtcactgtcggccaggatttggtgcgcattgagctcggtggcgcgccg
tcgggcgataagccggccgcgacggaggccaaagagacgcctaaggagacgcctaaggag
acgcccaaggagccagcacccgagaaacagacggagcaaaagaatgcgccagagcccaag
ccgcaggaaacgaagccggctactccatctgccccggcgaaggaagagtcggctgcgccg
aagcagccggccaaaccggcaaaagccaccaccgaagctcctgccactctgggtagccgg
gaagaaaggagggtgaagatgaaccggatgcgtctccgcatcgcggagcgcctcaagcag
tcccagaatactgctgcctcgctgaccacattcaacgaggtcgacatgtcggccctgatt
gagttccgcaataagtacaaggatgaggtcctgaagaagacgggcgtgaagctgggcttc
atgagcgccttctctcgcgcttgcgttctcgctatgcgcgatatcccggtagttaatgcg
tcaatcgagggccccaatggtggcgacaccatcgtctatagggactacgtcgatatcagc
gttgccgtcgcaacagagaagggccttgttacccccgttgtacgcaacgtagagaccatg
gacatgattgagatcgagaaggctattgccgagatgggcaagaaggctcgtgatggcaaa
cttacgattgaggatatggctggcggtactttcaccatcagtaacggaggggttttcggt
tcccttatgggcactcctatcattaacctgccacagagtgcggtgctcggcctccacgcc
atcaaggatcgccccgtggccgttaacggcaaagtggagatccgcccgatgatgtacctt
gccctcacctacgatcaccgtctgctggatggcagggaggcggtgcagttcctggtcaag
gttaaggagtacattgaggacccccgcaaaatgctcctttag

DBGET integrated database retrieval system