KEGG   Thermothelomyces thermophila: MYCTH_2124177Help
Entry
MYCTH_2124177     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K10739  replication factor A2
Organism
mtm  Thermothelomyces thermophila
Pathway
mtm03030  DNA replication
mtm03420  Nucleotide excision repair
mtm03430  Mismatch repair
mtm03440  Homologous recombination
Module
mtm_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    MYCTH_2124177
   03420 Nucleotide excision repair
    MYCTH_2124177
   03430 Mismatch repair
    MYCTH_2124177
   03440 Homologous recombination
    MYCTH_2124177
DNA replication proteins [BR:mtm03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    MYCTH_2124177
DNA repair and recombination proteins [BR:mtm03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     MYCTH_2124177
   MMR (mismatch exicision repair)
     MYCTH_2124177
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     MYCTH_2124177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RPA_C tRNA_anti-codon RMI2 Pfg27
Motif
Other DBs
NCBI-GeneID: 11508298
NCBI-ProteinID: XP_003660483
JGI: 2124177
UniProt: G2Q3H8
Position
1:join(8722604..8722621,8722770..8723031,8723107..8723219,8723324..8724043)
Genome map
AA seq 370 aa AA seqDB search
MLFPSKTWTACPTWVVQVVVASELCESGNEQVSAPYQPQDPTRSICLRGTRKVLAAQARR
SASCTCHLAPRHLATHSTPIGSHPAYTGRLLIMTSYGGYQRTGYGAQGGEDGGGFMGASQ
QGSQGGGSGGKADDTLRPVTIKQLIDCKEAYPGAELAVDGVPTTQVTLVGQVRSVAPQAI
NVVYRLDDGTGVIDVKKWIDAEKPDSVQQFAPGTYVRVFGRLQSFNNKRQVSAHYIRAIE
DFNEVNYHLLEATYVHLALTKGPAGGAGQQHQDDGGDSMFVDGGYGAAGGGGDGGGSVAM
QARLGSCSRNAKTVFNYLANAPGTDGVHLNQVASGTGLSAKDIMAATEELLGQGLIYTTQ
DDETWAILDY
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgctgttcccttcaaagacctggaccgcctgcccgacctgggtggtccaagttgtagtt
gcgtcagagctgtgcgaatcagggaacgaacaagttagtgcgccttatcagcctcaggac
cccacacgcagcatctgcctgcggggcacgcgtaaagtgcttgctgcccaggcgcgtcgc
agcgcgtcttgcacttgccatcttgccccccgccatcttgcaacacactcgacacccatc
ggatcccatccagcatatacaggcagactacttatcatgacatcgtacggcggctaccaa
cgaacgggctacggcgcccaaggcggcgaagatggcggcggtttcatgggcgcatcgcag
caaggaagccaagggggcggcagcggaggaaaggcggacgacaccctccgcccagtaacc
atcaaacaattgatcgactgcaaagaagcttatccgggcgccgagctggccgtggacggc
gtgccgaccacccaggtgactctcgtcggtcaggtgcgctcggtggctccgcaggcgatc
aacgtcgtgtaccgcctcgacgacggcaccggcgtgatcgacgtcaagaagtggatcgac
gccgagaagcccgattccgtgcagcagttcgccccgggcacgtacgtgcgcgtgttcggc
cgcctgcagagcttcaacaacaagcgccaggtcagcgctcactacatccgcgccatcgag
gacttcaacgaggtcaactatcacctgctcgaggcgacgtatgtgcacctggccctgacc
aagggcccggccgggggcgccgggcagcagcaccaggacgacggcggcgacagcatgttt
gtggacggcgggtacggggccgccggcggcggcggcgacgggggcggctcggtggcgatg
caggcgaggctggggtcgtgctcgaggaacgcgaagaccgtcttcaactacttggccaac
gcacccgggaccgacggtgtgcacctcaaccaagtcgcgtcggggacgggcttgtcggca
aaggatatcatggctgctacggaggagctgctgggtcagggcctcatctacaccacgcaa
gacgatgagacgtgggctatcctggattactaa

DBGET integrated database retrieval system