KEGG   Thermothelomyces thermophilus: MYCTH_2143314Help
Entry
MYCTH_2143314     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K05928  tocopherol O-methyltransferase [EC:2.1.1.95]
Organism
mtm  Thermothelomyces thermophilus
Pathway
mtm00130  Ubiquinone and other terpenoid-quinone biosynthesis
mtm01100  Metabolic pathways
mtm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    MYCTH_2143314
Enzymes [BR:mtm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.95  tocopherol O-methyltransferase
     MYCTH_2143314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_23 Methyltransf_25 Methyltransf_12 Methyltransf_31 CMAS Methyltransf_PK Ubie_methyltran Ribosomal_60s Methyltransf_32
Motif
Other DBs
NCBI-GeneID: 11512235
NCBI-ProteinID: XP_003662182
JGI: 2143314
UniProt: G2Q7S8
Position
2:complement(join(4531653..4531812,4531874..4531991,4532105..4532820,4532923..4533101))
Genome map
AA seq 390 aa AA seqDB search
MSTGTTTTPSTAQASGGDEATDLSKQYDTPLGLAHTTMQALKDRIKLHYDLASDYYLNLW
GEHIHHGYWPTESSKANDSKETAQLNLIRLLLSISGLLPQERDGNGEEKQLRILDVGCGI
GGTTRYLASALAAAVTGITISGKQVQIASRLSRSAAAAAAAAARGPGLDAPPAAAASGGG
DDDDDDDADGFIPLGDKGGKVRFVELDAEQMGDYFASSTSSASASASSPGREGGGNGGQG
LFDVVWISEALSHFPNKVLFFRNAHRLLRPGGKLVLADWFKAEDLEDGVFEADIKPIEDG
MLLPPLCTQQEYVGLATDAGLKVLGGPKDISKDVSKTWDISWSLVQNPSLWAFAFSQGRD
GIAFLQAFRAMRRGYANGSFRYAVMSFAKP
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccggtactacgaccaccccttcgactgcccaagcctctggcggcgacgaggcg
acagacctcagcaagcaatatgacacgcctctgggcctcgcacacaccacgatgcaggct
ctcaaggaccgcatcaagctgcactacgacctcgccagcgactactacctgaacctgtgg
ggtgaacacatccaccacggatactggcccaccgagtcatccaaagcgaacgactccaag
gaaacggcccagcttaacctcatccgcctgctgctctccatctccggcctgctcccgcaa
gagcgggatggcaatggcgaagagaagcagctgcgcatcctcgacgtcgggtgcggcatc
ggcgggacgacgcgctacctggcttctgccctggccgcggccgtgacgggcatcacgatc
tcggggaagcaggtgcagatcgcgagcaggttgtcgagatccgccgccgctgctgctgct
gctgctgctcgtgggccgggcttggatgccccgccggcggcggcggcgagcggcggcggc
gacgacgacgacgacgacgacgcggacgggttcatcccgctcggcgacaagggcggcaag
gtgcggtttgtcgagctcgacgccgagcagatgggcgactacttcgcctcttcgacctcg
tcggcgtcggcgtcggcgtcgtcgcctgggcgcgaaggcggaggaaacgggggacagggt
ttgttcgatgtcgtctggattagcgaagcgctctcgcacttccccaacaaggtcctgttc
ttccgcaacgcgcaccggctgctccgccccggcgggaaactggtgctggcggactggttc
aaggccgaggatctggaggacggtgtctttgaggcggatatcaagcctatcgaggatggc
atgcttctcccaccgttgtgcacgcagcaagagtacgtgggcctggctacggatgctggc
ttgaaggttttgggcgggccgaaggatatcagcaaggatgtaagcaagacttgggacatc
tcgtggtcgctggtgcagaatccctcgctgtgggcatttgcctttagtcagggaagagac
ggcatcgccttcttgcaggccttccgcgccatgagaagagggtatgcgaacgggagcttc
cgatatgctgtcatgtcctttgcgaagccgtaa

DBGET integrated database retrieval system