KEGG   Thermothelomyces thermophilus: MYCTH_2299007Help
Entry
MYCTH_2299007     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
mtm  Thermothelomyces thermophilus
Pathway
mtm00564  Glycerophospholipid metabolism
mtm00565  Ether lipid metabolism
mtm00590  Arachidonic acid metabolism
mtm00591  Linoleic acid metabolism
mtm00592  alpha-Linolenic acid metabolism
mtm01100  Metabolic pathways
mtm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MYCTH_2299007
   00565 Ether lipid metabolism
    MYCTH_2299007
   00590 Arachidonic acid metabolism
    MYCTH_2299007
   00591 Linoleic acid metabolism
    MYCTH_2299007
   00592 alpha-Linolenic acid metabolism
    MYCTH_2299007
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     MYCTH_2299007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA2_B
Motif
Other DBs
NCBI-GeneID: 11505907
NCBI-ProteinID: XP_003660556
JGI: 2299007
UniProt: G2Q4B6
Position
1:8967231..8969765
Genome map
AA seq 844 aa AA seqDB search
MALHIRNLTHLNRPKLPTSSRQQLGLFAQGNRPRLTNTSLGLSFDRRLPRRCLFSSPQRR
RSTLRTTKLISVTLTSALLSIWLYPTDALQHTDSLAELASGNSGKDGDGANTDEDQGARA
SFTRSFSALSFVPSTDGLSEKVVELIMPEWAKFIPGYVRKLQREMNMEPGSLAANIWHEA
QDPYTHPEIQYQAKVRVSGDLCEDEKIFLDRRKKMIVPALARYLGIDERDIHPDDVPTIA
MCGSGGGLRALVAGTGSFLATTEDGLFDCTTYVSGVSGSCWLQCLYYSSVTGANFQKGID
HLKARLGTHIAYPPVAFNTLTSSPTNKYLLSGLVEKLKGDPRSQFGLVDIYGMLLAARLL
VPKGELGVNEKDFKLSNQREYTRYGQNPLPIYTAVRHEIPELDSPDYGGPGSLTEEAKNR
AKREAWFQWFEITPYEFFCEEFSAGIPTWAVGRKFKNGADLPSESGFRLPETRLPLLLGI
WGSAFCATLSHYYREIRPIIKSLAGFRPVDELIWGHNKDLSKVHPIEPASIPNFVHGMYG
QLLESVPQAVYDNEYIQLMDAGMSNNLPIYPLLRPGRDVDIVVAFDASADIKTDNWLSAV
EGYARQRNIKGWPVGIGWPKPKAAPSVAAAELEQAQAHSAAEAEGKITQAKADQAARHPE
APSTTTAATASPTDSDQQAPELPGSQPTKPDTQRHSEAATELGYCTVWVGTTQERSSDHP
PPPPVDDTSTWRLMEPDAGIVVVYLPFLANERAAPGVDVATSDYLSTWNFVYTPDQIDQV
IALARANYGEGRERIRATVRAVYERKRRRREERERKEKTAEWRRQVRKGVAGAVGEGAHG
DHFS
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttcacattcgaaacctcacgcacctcaatcgcccgaagctcccgacctcatct
cggcagcagctcggcctctttgcccaaggcaatcgaccgcggcttacaaacaccagcttg
gggctctcttttgaccgacgactcccccggcgctgcttgttctcttcgccccagcgccgt
cggtcgaccctgcgcactaccaagctgatatcggtgacactcaccagcgcattgctttca
atctggctatacccgactgatgccttgcagcataccgactcactggcggagctagcctcc
gggaactcgggaaaagatggagatggggccaataccgacgaggaccagggcgcccgggcc
agcttcacaagatccttcagtgcgctctcctttgtcccttcgacagacggactctccgag
aaggttgtggaattgatcatgcccgagtgggccaagttcatacccggatatgtcaggaag
ctgcagcgcgagatgaatatggaacccgggtcattggcggccaacatctggcatgaggcc
caggacccgtatacgcacccggaaatccaatatcaggccaaggttcgcgtctcgggagac
ttgtgcgaagatgagaagatattcctggaccggagaaagaagatgattgtgcctgctctg
gcgcgttatctaggaatcgacgagcgggatatccacccggatgatgtccctacaattgcc
atgtgtggctccggcggcggtctcagagccctggtcgcaggaacgggctcgttcctcgcg
acgacagaagatgggctcttcgactgcaccacctacgtctcgggcgttagcggatcctgc
tggctgcaatgcctctactactcctcggttaccggggccaactttcagaagggtatcgac
cacctcaaggcgcgcctcggtacgcatattgcctacccacccgtggctttcaacacccta
acgtcatcacccaccaataaataccttctgagtggtctggtggagaagctcaagggcgat
ccccggtcccagttcggtctcgtcgacatctacggtatgctcttggcggcgcgtctcttg
gttccaaagggcgagttaggtgtgaacgagaaggacttcaaactatcaaaccagcgagaa
tacacgagatatggccagaatcccctcccgatttacacggctgtgcggcacgagataccg
gagctggactcgcccgactacggtggtccggggtccctcacggaggaggcgaagaaccga
gctaaacgggaggcgtggttccagtggttcgaaatcactccttatgagttcttctgcgag
gagttctcggccggcattcccacttgggccgtcggccgcaagttcaagaacggcgccgac
ctgccctcggaatcgggcttccgcctccccgagacccgcctgcccctgctcctgggaatc
tggggcagcgcgttctgcgctaccctgagccattactaccgcgagatcagacccatcatc
aaaagtctcgccggtttccggccggttgacgagctcatctggggccataacaaagacttg
agcaaggtccatccgatcgagccggccagcattcccaactttgttcatggcatgtacggc
caactgcttgaatccgttccccaagccgtctacgacaacgaatacatccaactcatggac
gccggcatgtccaacaaccttcccatctaccctctcctccgcccgggccgggatgtcgac
atcgtcgtagccttcgacgcctcggccgacatcaaaactgataactggctctcagcagtg
gagggctatgcccgccagcgcaacatcaaaggctggcccgtgggtattggctggccaaag
cccaaggcggccccatccgtcgccgccgccgagctcgagcaagcccaagctcattcggcc
gccgaagcagaaggcaagatcacccaagccaaagccgatcaggcggctcggcacccggaa
gcgcccagcactaccaccgccgccaccgcttccccgactgacagcgaccaacaagcgccc
gaactaccgggctcgcaaccgacgaagccggacacccaacgacatagcgaagccgccacc
gagctgggctattgcacggtctgggtaggcacaacgcaagagcggtcgtcggaccacccg
ccgccgcctcccgtcgacgacacgagcacgtggcggctgatggagccggacgcgggcatc
gtggtcgtgtacctgccgttcctggccaacgagcgggcggcgccgggcgttgacgtggcc
acgagcgactacctgagcacgtggaactttgtgtacacgcccgaccagatcgaccaggtg
atcgcgctcgcgcgggcgaactacggcgagggcagggagcggatccgcgccaccgtccgg
gccgtgtacgagcggaagcgtcggcggcgggaggagagggagcgaaaggagaagacggcc
gagtggaggcgacaggtcaggaagggtgtcgcgggggccgtcggggagggggctcacggg
gaccatttcagctag

DBGET integrated database retrieval system