KEGG   Thermothelomyces thermophila: MYCTH_2303514Help
Entry
MYCTH_2303514     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K18670  dual specificity protein kinase YAK1 [EC:2.7.12.1]
Organism
mtm  Thermothelomyces thermophila
Brite
Enzymes [BR:mtm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     MYCTH_2303514
Protein kinases [BR:mtm01001]
 Serine/threonine kinases: CMGC group
  DYRK family [OT]
   MYCTH_2303514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH RIO1
Motif
Other DBs
NCBI-GeneID: 11512719
NCBI-ProteinID: XP_003662643
JGI: 2303514
UniProt: G2QCX8
Position
3:complement(join(897420..898216,898281..899019,899075..899234,899291..899490,899553..900338))
Genome map
AA seq 893 aa AA seqDB search
MEQWQAYNDPAGAGGPRRYNGSTGNQMSPRDFGSSGQNPAQQPPAGFKYDNYQGGLNPHQ
TTSSAASPMSSPHLRDGNGDVPMQDSHDSYGSLSTSAKYPMRPHHQHHLSSGRTANLQQE
PSAAAQRYSPMEVMSPTSPYGPKTASSGQFSQQPAQRQSPTRSSDYAPQQSPYYGSRQAA
PQLPPINQYANNQETYSPSAMTPMDGSYADPKSPKRAPPQSATHDRGPVPEFRRIRAPTD
LKPKVNDQPPFRRANPEGGFISPLQALTVQLPATYRICNPAFKYESSRNPRRVLTKPSKG
VKNDGYDNEDSDYILYVNDILGSEEAGHKNRYLILDVLGQGTFGQVVKCQNMKTQEVVAV
KVIKNRTAYFNQSMMEVSVLDLLNTKLDKNDDHHLLRLKDTFIHRQHLCLVFELLSVNLY
ELIKQNQFRGLSTTLVRVFAQQLLNGLALLNKARLIHCDLKPENILLKNLESPIIKIIDF
GSACDERQTVYTYIQSRFYRSPEVLLGLPYSSAIDMWSLGCIVVELFLGLPLFPGSSEYN
QVSRIVEMLGNPPNWMIEMGKQAGEFFEKRQDEFGRRTYHLKSMEQYSREHGVKEQPSKK
YFQANTLPEIIKSYPMPRKNMKPSEIEREMNNRIAFIDFVRGLLTINPLERWSPQQAKLH
PFITQQKFTGQFVPPMNLKSSALNRSPAPGTQQQLQAEALSKQRAQAAQAQAQASTAAKG
AYGSMGPVQYQQQGHAQQQPLYGSNNMYTPTNTHPGAPPPYSGQQGGYGQMGMGQTGVQM
PPANYTQSNMYAQQNRPRQRASTMEQQSGIPASIQRVASHLDPNQPIRLQPSPAYYPPPP
EGLAGMDHQTSNRQPRRGSRAQQTGRGNRDFIRNLEERTLEEGFMGSGQSPWH
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atggagcaatggcaggcgtacaacgaccctgccggcgccggcggcccgcgacgatacaat
ggaagcactggcaatcagatgtcaccccgagactttggtagcagcggccagaacccggcg
caacaacccccggcgggcttcaagtacgataactaccaaggcggcctaaacccgcaccag
acgacatcgtcagcagcatcgcccatgtcgagccctcatctgcgcgacggtaacggcgac
gtcccgatgcaggactcgcacgattcctacggcagcctgagcaccagcgccaagtacccc
atgcggccccatcatcaacaccatctctcgagcggccgcaccgccaaccttcagcaagag
ccctccgctgccgcacagcgatactcgcccatggaggtcatgtccccaacgtcaccttac
ggccccaagacggccagctccggccagttttcgcagcagcccgcgcagagacaatcgccc
acccgctcctcggactatgccccgcagcagagcccgtactacggcagccgccaggcagct
cctcaactaccacccatcaaccaatacgccaataaccaggaaacatactcgccgtcggcc
atgactcccatggatggctcatatgcggacccaaagtcgcccaaacgagccccgccgcag
tcggccacgcatgacagggggccggtgcccgagttcaggcgcatccgggcgccgaccgac
ctgaaacccaaggtcaacgaccaaccgccgttccgacgagcgaatcccgaaggcggcttc
atcagccccctgcaagcgcttaccgtgcaactccccgccacttaccggatctgtaacccc
gcgttcaagtacgagtcgtcgcgcaatccacgccgcgtcctgacgaagccgagcaaggga
gtgaagaacgatggctacgataacgaagacagcgattacatcctatacgtcaacgacatc
cttggttcggaggaagctggacacaagaaccggtatctgatcctggacgttcttggccag
ggtaccttcggccaagtcgtgaagtgccaaaacatgaagacgcaggaggtcgtcgccgtc
aaggtcatcaagaaccgcacggcatatttcaaccagagtatgatggaggtgtctgttctt
gatctgcttaacaccaaattagataagaacgacgaccaccatctgctgcggctcaaggat
acattcattcacagacagcatctgtgcttggtgtttgagctgctcagcgtgaatctgtac
gagctgatcaagcagaaccagttccggggtctcagcacaacccttgtccgcgtctttgct
cagcagctcctcaatggattggccttgctgaacaaggcaaggctgattcattgcgatctc
aagccggagaacatcctcctaaagaacctcgaaagcccgatcatcaagatcatcgatttc
gggtccgcatgcgatgaacggcagacggtctatacatatatccagtctagattctaccgg
tcgcctgaggttcttctcggcttgccgtactcttcagccatcgatatgtggtcgctgggt
tgcatcgtcgtcgagctgttcctcggcctgcccctcttcccgggttcatccgagtacaac
caggtctccaggatcgtcgagatgctcggaaaccctccaaattggatgattgagatgggc
aagcaggccggagagtttttcgagaagaggcaggacgagttcggccggcggacttaccac
ctgaagagcatggagcagtactcgcgcgaacacggcgtgaaagagcagcctagcaagaag
tacttccaggcgaacacgctacccgaaatcatcaagtcgtacccgatgccgcggaagaac
atgaaaccgtcggaaattgagagggagatgaataaccgcatcgcctttatcgatttcgtc
aggggcttgttgaccatcaatccgcttgagagatggtccccgcagcaggcaaaattgcac
cctttcatcactcaacaaaagttcacaggccagttcgtgccacccatgaacctcaaatcg
agcgctttgaaccggtcgccggctcctggcacacaacagcagctacaggccgaagccctg
agcaagcagagggcgcaggctgctcaggctcaagcccaggcaagcacggcggccaaaggg
gcctatgggtcgatgggtccggtacaataccagcaacaaggccacgcacagcaacaacca
ctctatggaagcaacaacatgtacaccccgacaaacacgcaccccggagcgccgccacca
tacagcggccagcagggcggatacggccagatgggtatgggacagacgggggtgcaaatg
ccgccagccaactacacccagtccaatatgtacgcccagcagaaccgacccaggcagcgt
gcctcaacaatggaacagcagagcggcatccccgcctcgattcaaagggtcgccagtcat
ctggatcccaaccagcccattcgacttcaaccaagccctgcttattaccctccgcctcca
gaaggactcgccggcatggaccaccaaacttcaaataggcagcccaggagaggaagccga
gcacagcaaacgggtcgtggcaaccgcgactttatccggaacctggaggagaggacgctg
gaggaagggttcatgggcagcggtcagagcccgtggcattga

DBGET integrated database retrieval system