KEGG   Thermothelomyces thermophilus: MYCTH_2304142Help
Entry
MYCTH_2304142     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K21456  glutathione synthase [EC:6.3.2.3]
Organism
mtm  Thermothelomyces thermophilus
Pathway
mtm00270  Cysteine and methionine metabolism
mtm00480  Glutathione metabolism
mtm01100  Metabolic pathways
Module
mtm_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:mtm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    MYCTH_2304142
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MYCTH_2304142
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtm04147]
    MYCTH_2304142
Enzymes [BR:mtm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     MYCTH_2304142
Exosome [BR:mtm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MYCTH_2304142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH_synth_ATP GSH_synthase
Motif
Other DBs
NCBI-GeneID: 11507559
NCBI-ProteinID: XP_003662933
JGI: 2304142
UniProt: G2QEA5
Position
3:complement(join(1876153..1877191,1877241..1877377,1877436..1877511,1877571..1877869))
Genome map
AA seq 516 aa AA seqDB search
MSSLIGGIYPPTLDDGVERDQLVQTIKDWTIANGLAVRPPPAFADGEFEGALAISAPVTL
FPSPFPKACFEEARAIQTKYNELYARISQDEEYLGSLVQEVAGGDDFIANLWKVHLRVKE
EGYVQNLSLGLFRSDYMVHQDGDNLQIKQVEFNTIASSFGGLSTQTSLLHKHLAKTEYPL
LKEPVSLPPADLPPNPSAEGLAAGLAAAFHAYGKSALGHQTCVLFLVQDEERNVFDQRHL
EYALRSSGAEPIPVFRLPFSQILTHTTIPPSSPGRQLLYHPPQNPARTFEVAVVYLRAGY
GPADYPSQSAWEARYQIERSAAIACPSVLTQLAGMKKVQQVLATPEAVTSGPGALRRFVP
DSDGDATYQALWKTFANIYPLDTSPAGLEARRLATDPEECKRFVMKPQREGGGNNFYRTA
IPRRLSEIPESHWGSYILMELITPPPLVNTILRNGKLEHGGVICELGIYGTCLWDQKTGA
VLRNEESGYLLRTKGDQSEEGGVAAGYGCMDSCRLV
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccctaatcgggggaatctatccgccgaccctggatgatggtgtggagagagac
cagctcgtgcaaaccatcaaggactggaccattgcgaacggccttgctgtacggccccct
ccggcatttgccgacggtgaattcgaaggggctctggccattagcgccccagtaacactc
ttcccgagcccgttccccaaagcctgtttcgaggaggccagggccatccaaaccaagtac
aatgagctgtacgcccgcatcagccaggatgaggagtacctcggcagtcttgtgcaggag
gtcgctggaggcgacgacttcattgccaacctgtggaaggttcacctgcgggtgaaagag
gagggctatgtccagaatctcagcctcggcctcttccggtccgactacatggtccaccag
gatggcgacaacctccagatcaagcaagtcgagttcaacaccatcgcatcctcgtttggg
gggctttccactcagacttctttgctccacaaacatctcgccaaaaccgagtatcccctc
ctaaaggaaccggtgtcgctcccccctgccgacctcccccccaatcccagcgcggagggc
ctcgccgcaggactagcagctgcattccacgcctacgggaagtccgcccttggccaccag
acctgcgtcctcttcctcgtccaggacgaggagcgcaacgtcttcgaccagcgccacttg
gaatacgccctccggtcctctggcgcggaacccatccccgtcttccgcctccccttctct
cagatcctcacgcatacaaccatccccccttcctccccgggccgtcagctcctctaccac
ccaccccagaaccctgcccgcaccttcgaggtcgccgtcgtctacctccgcgccggatac
ggcccagcggactacccgtcccagtcggcctgggaagcacgctaccagatcgagcgctcg
gcagccatcgcctgcccgtcggtgctcacccagctggccggcatgaagaaggtccagcag
gtactcgccaccccggaagccgtcacctccggcccgggcgccctgcgccgcttcgtcccc
gacagcgacggcgacgccacctaccaggccctctggaagacgttcgccaacatctacccc
ctggacaccagccccgcggggctggaggcgcggcggctcgcgacggacccggaggagtgc
aagcggttcgtcatgaagccgcagcgcgagggcggcgggaacaacttctaccggacggcc
atcccgcggaggctgagcgagatccccgagagccactggggttcgtacattctgatggag
ctgatcacgccgccgcccctggtgaacaccattctgcggaacgggaagctggagcacggc
ggtgtcatctgcgagctggggatctacgggacgtgcctgtgggaccagaagactggggcg
gttctgcggaacgaggaaagcgggtacctgttgcggacaaagggcgatcagagcgaggaa
gggggtgtagcggcggggtacgggtgtatggattcttgccggttggtctag

DBGET integrated database retrieval system