KEGG   Thermothelomyces thermophilus: MYCTH_2306323Help
Entry
MYCTH_2306323     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
mtm  Thermothelomyces thermophilus
Pathway
mtm00760  Nicotinate and nicotinamide metabolism
mtm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    MYCTH_2306323
Enzymes [BR:mtm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     MYCTH_2306323
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     MYCTH_2306323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 11513492
NCBI-ProteinID: XP_003664017
JGI: 2306323
UniProt: G2QHB2
Position
4:complement(join(1775114..1775221,1775279..1775517,1775572..1775595,1775654..1775909,1775982..1776076,1776136..1776307))
Genome map
AA seq 297 aa AA seqDB search
MSTGSSDSGTQTPSATVEQPNLNGAQQSYTFPTEKLKRRQTQPGKTPLVLVACGSFSPIT
FLHLRMFEMASDFVRFNTDFEVCGGYLSPVSDAYKKVGLAPGVHRVNMCARAVEQSSWLM
VDPYETVNCDEKGEPRYVPTAKVLRHFDYEINEVLGGIEGTDGQRKKARIALLAGADLVM
SMGEPGLWAPKDLDTILGQYGAFIIERSGTDIDEALASLRQYEHNIWVISQVIQNDISST
KVRLFLKKDLSVRYLIPDPVVEYIEEHGLFSEPSANKSRSRTPDVASGPSDNKPTKG
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactggatctagcgattccggcactcaaacgccctcggcgaccgtggagcaaccg
aacctcaatggcgctcagcagtcctacacttttccaaccgaaaagctgaagcgccgccaa
acacagcctgggaagacacccctcgtgctggtggcctgcgggtcgttctctccaataacc
ttcctccacctccgcatgttcgagatggcaagcgactttgtccggttcaacaccgacttc
gaagtgtgcggcggatatctgtcaccggtcagcgacgcttacaagaaggtggggctagcg
cccggcgtccaccgggtcaatatgtgcgcgagagccgtcgagcagtcgtcctggctcatg
gtcgacccgtacgagacggtcaattgtgacgaaaagggggagccgcgatacgtgccgacc
gccaaggtcttgcgccactttgattacgaaatcaatgaagtgctcggaggtatcgagggc
acagatgggcagagaaagaaggctcggattgcgcttctggctggcgccgacttggtcatg
tctatgggtgagcctgggctttgggcaccaaaggatctcgatacgatcctcggccagtac
ggcgctttcatcatcgagcgctccgggacggatatcgacgaggctctcgcctccctcagg
cagtatgagcacaacatttgggtgatcagccaggtcatccagaacgacatcagctctact
aaggttcggctgttcttgaagaaggaccttagtgtcaggtacctgattccggatcccgtc
gtcgagtacatcgaggaacacggcctgttttcggaacccagcgcgaacaagtctaggagc
cggacaccggatgttgcttctgggccttcagacaacaagcctaccaagggctga

DBGET integrated database retrieval system