KEGG   Thermothelomyces thermophilus: MYCTH_2306786Help
Entry
MYCTH_2306786     CDS       T02231                                 

Definition
(RefSeq) carbohydrate esterase family 9 protein
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
mtm  Thermothelomyces thermophilus
Pathway
mtm00520  Amino sugar and nucleotide sugar metabolism
mtm01100  Metabolic pathways
mtm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mtm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MYCTH_2306786
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     MYCTH_2306786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3 Presenilin Pex14_N CCDC53 DUF4834 DUF719
Motif
Other DBs
NCBI-GeneID: 11513923
NCBI-ProteinID: XP_003664214
JGI: 2306786
UniProt: G2QEU0
Position
4:join(2447724..2448107,2448191..2449083,2449289..2449547)
Genome map
AA seq 511 aa AA seqDB search
MPSAIRSGSPRHTGITKLTNCRLVRGDELVWDDIWVSSATGKIIRSQSAFYDELIMPDEV
VDLGGRIVSPGFIECQLNGAYGFNFSTMTDDMSQYGKQLRDLNKKLARTGVTSYVPTVTS
QTSELYKKVLPYLGPSGSSRRAHDGAESLGAHVEGPFLNPTKNGVHNTSVLRVANSLSDL
EDMYGAANITPSASSSSSSASSQDSDSSSTSGPEEEGKVEEKKHGREGTIPIKMITAAPE
LGAMTSLIPALASRGIVVSIGHSEATYEQASAAVAAGATMITHLFNAMRPLHHRNPGIFG
VLGAPEPQRQQQEQQKQPTTPPPSPQWQQQQQQQQEQEQEQQKKQQQPPKRPYFGLIADG
IHLHPATVKIAWHAHPAGLVLVTDAMHMVGLPDGRYPWTNGEGEHFIVKKGSVLELEGTG
GVIAGSSITLVECVSNFLNYTGATVPEALRAVTATPAAMLGLEVVKGCLEAGADADLVVL
SENNDEGGRRELVVDEVWKFGVRIFERGRDC
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgccatcggctatccgctcggggtcaccccgccacaccggcatcaccaagctgaccaac
tgccgcctcgtccgcggcgatgagctagtgtgggacgacatctgggtcagctcggccacg
ggcaagatcatccgcagccagtcagccttctacgatgagctcatcatgcctgacgaggtc
gttgacctcggcggccgtatcgtgtcgcccgggttcatcgagtgccagctgaacggagct
tacggcttcaatttctccaccatgaccgatgacatgtcccagtacggcaagcagctgcgg
gacctcaacaagaagttggcccggacgggagtcacctcctacgtgccgaccgtgacgagc
cagacgagtgaactctacaagaaggtcctcccatacctcggaccgtcaggctcctctcgc
cgagcccacgatggcgccgaatccctgggtgcccatgtcgaagggccctttctgaaccca
accaagaacggggtgcacaacacctccgtcctacgcgtcgctaactcgctttccgacctg
gaggatatgtacggcgccgccaacatcaccccgtccgcctcctcctcctcctcctccgcc
tcctcgcaagactcggactcctcctcaacctcggggccagaggaggaggggaaagtggag
gagaagaagcacgggcgtgagggcaccatccccatcaagatgatcaccgccgcccccgag
ctcggggccatgacgagcctcatcccggccctcgcctcgcgcggcatcgtcgtctcgatc
ggccactcggaagccacgtacgagcaggcctcggccgccgtggccgccggcgcgaccatg
atcacccacctgttcaacgcgatgcggccgctccaccaccgcaacccgggcatctttggc
gtgctcggcgcccccgagccgcaacgacaacaacaagaacaacaaaaacaaccaacaacc
ccgccaccatcaccgcagtggcagcagcagcagcagcagcagcaggagcaggagcaggag
cagcagaagaagcagcagcagccgccaaagaggccctacttcggcctcatcgccgacggc
atccacctgcacccggccacggtcaagatcgcgtggcacgcccacccggccggcctggtc
ctggtcacagacgcgatgcacatggtcggcctgccggacgggcggtacccgtggaccaac
ggcgagggggagcacttcatcgtcaagaagggcagcgtgctggagctcgagggcacgggg
ggcgtgattgcggggagttccatcaccctcgtcgagtgcgtctccaacttcctcaactat
acgggcgccacggtccccgaggctctgagggccgtgacggctactcccgccgccatgttg
ggtctggaggtggtcaaaggatgtctcgaggccggcgcggatgccgaccttgtggtcttg
tcggagaacaacgacgaaggcgggaggagagaactggtagttgacgaggtgtggaagttt
ggtgttaggatttttgagcgcggccgtgactgctaa

DBGET integrated database retrieval system