KEGG   Thermothelomyces thermophilus: MYCTH_2306799
Entry
MYCTH_2306799     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
mtm  Thermothelomyces thermophilus
Pathway
mtm00910  Nitrogen metabolism
mtm01100  Metabolic pathways
Module
mtm_M00531  Assimilatory nitrate reduction, nitrate => ammonia
mtm_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:mtm00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    MYCTH_2306799
Enzymes [BR:mtm01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     MYCTH_2306799
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox NIR_SIR Rieske Fer2_BFD NIR_SIR_ferr Rieske_2 NAD_binding_9 Rubredoxin_C Amino_oxidase K_oxygenase NAD_binding_7 NAD_binding_8
Other DBs
NCBI-GeneID: 11513927
NCBI-ProteinID: XP_003664218
JGI: 2306799
UniProt: G2QEU4
Position
4:complement(join(2466901..2467990,2468110..2470157,2470230..2470380,2470445..2470509))
AA seq 1117 aa
MAVGTRKRVVVVGLGMVGISFIEKLLKLDARTREYDITVIGEEKHVAYNRVGLTTFFEHR
KVENLYLSPLEWYESIQDGALSYHLNTKVTKIDPSRKSVTCADGREVDYDILVLATGSDA
ILPRAVPNYDATGVFVYRTVDDLEKLIAFSAHQNGTVGAVVGGGLLGLEAAKALTDLQCY
SKVKVIERGKWLLTRQLDSVGGAMVADQVRALGVDVLLDKSVAGIEVDEQHRVTGVKLAD
GESFACSTICFAIGVRPRDELAREAGLKCADRGGIIVDSSLRTSDPDIYAIGECANWEGQ
VFGLIGPGVEMADVLSFNLTQAKLHQPRLYKQPDLSTKLKLLGVEVASFGDYFADVDGPK
LLPPKARRALAAKSATNGANGANGTNGAHSTHGVNGTKPDTSSSPVKALTYRDPFQNVYK
KYIFTADGKYLLGGMMIGDTRDYVKLVPMVKNQKELEIPPAELIIGAKKEGDDGDDLDDD
TQICSCHNVTKGDIVKVTKDGTCKSIGDIKACTKAGTGCGGCLPLVTSIFNKTMKDMGNE
VKNNLCPHFNYSRADLYNIIMVKRLKTIQEVMREAGTDPNSLGCEVCKPCLGSIFASLWN
KHVMGKPHHGLQDTNDQFLANIQRNGTYSVVPRMAGGEITPDKLMAIAQVAKEYNLYTKI
TGGQRIDMFGAKKQDLLDIWKKLVAAGMESGHAYAKALRTVKSCVGTTWCRYGVGDSVGM
AVRLEERYKSIRAPHKIKGGVSGCVRECAEAQGKDFGLIATEKGFNVFVGGNGGAKPRHA
ELLAKDVPPTEVIPILDRYLMFYIRTADRLQRTASWLESLPGGINYLRDVVLNDSLGINA
SLEAQMQELVDSYFDEWAEAVNSPAIAAKFRQFVNTDETVDNMELETDRHQTRPVMWTKE
QATDDFASLRHRWSQTTWQPVLEAAYFRGADDLPNGISATIKRGDTQLAVWRFKGRYYAT
QQMCPHKRAFILSDSLLGEDPAGGGDAASEGEGRQRPDPYISCPHHKKNFSLGSGACKND
SALSIATFDAEERDDGMVYLKLPPVQELDAALGTKKWRVKKGEAGPGQFAEVDKRIGFVG
QRAKKPGVKTMVNGELGMRKGLELMTAGGGCGGAPDW
NT seq 3354 nt   +upstreamnt  +downstreamnt
atggcggtgggaactcgcaagagggtcgtcgttgtcggcctgggcatggttggcatcagc
ttcatagagaaactcttgaagctcgatgcgaggacgcgggagtacgacatcacggtcatc
ggtgaagagaagcatgtggcttacaatcgcgttggcctcacgactttcttcgagcaccgc
aaggtcgagaacctgtacctcagcccgttagaatggtacgagagcatccaagatggcgcc
ctgagctaccatctcaacacaaaggtcaccaagatcgacccctcccggaaatccgtcacc
tgcgcggacgggagggaggtcgactatgacatcctcgtcctcgccaccggctccgatgcc
atcctgccccgcgcggtccccaactacgacgccacgggcgtctttgtctaccgcaccgtc
gacgacctcgaaaagctcatcgccttctccgcccatcagaatggcaccgtcggcgccgtc
gtcggcggcggcctgctgggcctggaagccgccaaggccctcaccgacctgcagtgctac
agcaaggtcaaggtcatcgagcgcggcaagtggcttctcacccgccagctggactcggta
ggcggcgccatggtggccgaccaggtccgcgcgctcggcgtcgacgtcctgctcgacaag
tccgtcgccgggatcgaggtcgacgagcagcacagggtaacgggggtcaagctcgcagac
ggcgagtccttcgcctgctcgacgatatgcttcgccattggcgtccgcccgagagacgag
ctcgcccgcgaggccgggctcaagtgcgccgaccgcggcggcatcatcgtggacagcagc
ctcaggaccagcgaccccgatatctacgccattggcgagtgtgccaactgggaggggcag
gttttcgggctgattggccccggcgtcgagatggcggacgtgctgtcgttcaacctcacg
caggccaagctccaccagccgaggttgtacaagcagcccgaccttagcaccaagctcaag
cttttgggtgtcgaggtcgccagctttggggactactttgccgacgtcgacgggcccaag
ctgctgccgcccaaggcgaggagagcgctcgccgcgaagagtgccacaaacggggccaac
ggggccaacgggaccaacggggctcatagcacccacggcgtgaatggcaccaagcccgac
acctcgtcgagccccgtcaaggccctgacatacagggacccgttccagaacgtgtacaag
aagtacatcttcaccgccgatggcaagtacttgctcggcggtatgatgatcggcgacacc
agagattatgtcaaactcgtgcccatggtcaagaaccaaaaggagctcgagatcccgccg
gccgagctgatcatcggcgccaagaaggagggcgacgacggcgacgacctcgacgacgac
acgcagatctgcagctgtcacaacgtcaccaagggcgacatagtcaaggtcaccaaggac
ggcacttgcaagtcgataggcgacatcaaggcgtgcaccaaggccggcaccggctgcggc
ggctgcctgcccctggtcacgtccatcttcaacaaaaccatgaaggacatgggcaacgag
gtcaagaacaacctgtgcccacacttcaactacagccgcgccgacctctacaacatcatc
atggtcaagcggctcaagacgatccaggaggtcatgagggaagcaggcaccgaccccaac
agtctcggctgcgaggtgtgcaagccatgcctgggcagcatctttgccagcctgtggaac
aagcacgtcatgggcaagccgcaccatggccttcaggacacaaacgaccagttcttggcc
aacattcagcgcaacggcacgtacagcgtcgtgcccaggatggccggtggcgagatcacc
cccgacaagctgatggcaatcgcccaggtggccaaggagtacaacctgtataccaagatc
acgggcggccagcgcatcgatatgtttggcgccaagaagcaggacctgctcgacatctgg
aagaagctggtcgccgcaggcatggagagcgggcacgcctacgccaaggccctgaggacc
gtcaagagctgcgtcggcaccacgtggtgcagatacggcgtcggcgacagcgtcggtatg
gcggtgcgtctagaggagcggtacaagagcatccgcgcgccgcacaagatcaagggcggt
gtaagcggctgcgtgcgcgagtgtgcggaagcccagggcaaggactttggcctcattgcg
accgaaaaggggttcaacgtcttcgtcggcggcaacggtggcgcaaagcccaggcacgca
gagctcctggccaaggacgtcccgcctaccgaagtgatcccgatcctggaccgctacctc
atgttctacatccgcacggccgaccggctccagcggacggcctcgtggctggaatcgctg
ccggggggcatcaactacctccgggacgtggtgctcaacgactcgctcggcatcaatgcc
tcgctcgaggcgcagatgcaggagctcgtcgacagctacttcgacgagtgggccgaggcg
gtcaactcgcccgccatcgccgccaagttccggcagtttgtcaacacggacgagacggtc
gacaacatggagctcgagacggaccggcaccagacccgccccgtcatgtggaccaaggag
caggccaccgacgacttcgcctcgctgcgccaccgctggtcccagaccacctggcagccc
gtcctcgaggccgcctacttccgcggcgccgacgacctccccaacggcatcagcgccacc
atcaagcgcggcgacacccagctggccgtctggcgcttcaagggccgctactacgccacc
cagcagatgtgcccccacaagcgcgccttcatcctctccgactccctcctcggcgaggac
cccgccggcggcggcgacgccgcctccgagggagaggggaggcagcggccggacccctac
atcagctgcccgcaccacaagaagaacttctcgctcggctccggtgcctgcaagaacgat
agcgccctgtccatcgccaccttcgacgccgaggagcgcgacgacggcatggtctacctc
aaactgccgcccgtccaagagctggacgccgccctcggcaccaagaagtggcgggtcaag
aagggggaggccgggccgggccagttcgccgaggtcgacaagcgcatcggcttcgtcggg
cagagggccaagaagccgggcgtcaagacaatggtgaacggcgagttgggaatgcgaaag
gggctggagttgatgaccgccggcggcggatgcggaggggcgcccgattggtga

DBGET integrated database retrieval system