KEGG   Thermothelomyces thermophilus: MYCTH_2309153Help
Entry
MYCTH_2309153     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K14289  exportin-5
Organism
mtm  Thermothelomyces thermophilus
Pathway
mtm03013  RNA transport
Brite
KEGG Orthology (KO) [BR:mtm00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    MYCTH_2309153
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mtm03016]
    MYCTH_2309153
   03036 Chromosome and associated proteins [BR:mtm03036]
    MYCTH_2309153
Transfer RNA biogenesis [BR:mtm03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    MYCTH_2309153
Chromosome and associated proteins [BR:mtm03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     MYCTH_2309153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Xpo1 IBN_N WYL
Motif
Other DBs
NCBI-GeneID: 11511202
NCBI-ProteinID: XP_003665442
JGI: 2309153
UniProt: G2QI08
Position
5:join(3311537..3312403,3312460..3312648,3312705..3313170,3313227..3313348,3313400..3313471,3313526..3313750,3313804..3313907,3313964..3314222,3314273..3314415,3314473..3315074,3315138..3315925)
Genome map
AA seq 1278 aa AA seqDB search
MAMNGAAGTAATGDGGEAVLSKIHEALKVVHSPYSPNQARQEAQAFLENVKSLPESPSHG
FSLAFNKPHEPIVRHYGLSLLEHAVKQNWEEYSTEHREYLRSWVLQLAETVSAEDPPYLR
NKIAQLWVEVAKRAWVASWMDMDHLLVRIWRGSDSPVYKQFVLQILETLSDEIFNGDDAV
VALREGVLSKACVEIFTPAAILTEAFPNRQAGPDVRCEDDGWLSRITQLIGECLSGGVEQ
TEDVTACAVKALKVLNSVVPWAIPKALNAVGCRAVMCSCLATPSVPVQKAALETLHSLYS
RSSFTEEEFVDLVVPMYTEIMVDLYRRLFEWSVVDPQDIDDDKYQFAKKFSELLCSLGNY
LDRKFAAIPPQTNVQGFLELLMLVVQSQSLVVSIPVLLTWTRLLSHRSLGPAAAEMPLIV
NLLEVCCARLIRYESFPEDSEDPVYVLLIEDTDTIPERHAFLGNYRRYCCSIIESIVHLK
MSDAFSHILGRAERALNTLYDGQPPLNPANYSKSSLPVLTFDAHATVIEAALKGYDKWRA
SRSRTNEEKQQATAVEEYFEKWCGQLLEMKFEDPLIRKRILQLLVTFSTRALDSNPAFML
RVLEHILMTWPALQPEHRLYNDAIRDLQTESMVELQRLASKMPDPLLDVYDQLEAKVQEM
IASGTLDEKRQIAYQSFLFIIVHRATHIDPAVRLSKLTAFIDPVKDQWKNESLKAALGSY
NGFCELLGLDKVQKYLTERRVHENADWGSTDLDAEGLALQAELEHRQSVLPLRVTKSFLT
YSVERIEKDSAPYQASCTLWQDGFQLILPELLKLLSYAHASHNPANWVLLPAEMQPTVGR
LLSDRFWQAGISEGSKDDFYARVLGKKNTLEGLASTVRGTIRFVRETCYAIIYCMTRLNT
QFYGFLELPGPLANALFADSVYLSSHQVINLLTLVRFLVDNCPAELREHFVPPILAACFE
QMDAKISSEWEKLGQREAVQAAGDELTEEMKAESILRQLTYSAVLMVADVLDPARVAAPS
ASEEQPVDAASSAKYPPLRKFCLMNPSIAVPLLVFCSHAIRMHDGRSCGVVLRVFRSIIP
EFSPSEVPRTMKDSGHTEPLEDFPIPEETARDIREFISTEVLKAAISSLHDPYFVDLQRE
LGALIAQILAYYASLTPTPRNILVSLPNIKPEDVDRTIQQVSQTGMHSRQQRALVLELLE
DLKGVSISEMGKLTKSFGARPGSARGNKKSARSKMAQEFMTPQAGSGGGGRRTDGDGSAA
RNKTPDLEGMAGMFNEAE
NT seq 3837 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgaacggagccgctgggactgccgccaccggcgatggcggtgaggccgtccta
tcgaagatccacgaagcgctcaaagtagttcacagcccctactctccgaatcaagcccga
caggaggcccaagccttcctcgagaacgttaagagccttcccgagtcaccttcgcacggc
ttcagtctcgcgttcaacaaaccgcatgaacctatcgtccggcattacggcctgtcgctg
ctcgagcatgcagtcaagcaaaactgggaggaatatagcacggagcaccgagaatacctc
cgctcctgggttctgcagctggcggaaaccgtttccgccgaagatccgccctatctaagg
aacaagattgcccagctgtgggttgaagtggccaagcgtgcttgggtcgccagctggatg
gacatggaccatcttttagtccgtatctggcggggctccgactcgccagtttataaacag
ttcgttcttcaaatcctcgagacactctccgacgaaatcttcaatggtgacgacgctgtg
gttgcccttcgtgaaggagtgctgagcaaggcatgcgtggagatttttacaccagcagca
atcctaaccgaggctttccctaatcgtcaagctggtccggacgtacggtgtgaggacgat
ggatggctcagtaggatcacacaactcatcggcgagtgcttgagcggtggcgtcgagcaa
accgaggatgtcactgcatgcgctgtcaaggcactcaaagttctcaactcggtggtgcca
tgggcgattcccaaagcattgaatgccgttggctgccgcgccgtcatgtgcagttgtctc
gcaactccaagcgtgcccgtgcaaaaggctgctctcgagactctgcattcgctctatagc
cgctcaagtttcaccgaggaagagttcgtcgacctcgtagtgccaatgtacaccgagatc
atggttgatctctataggcgactatttgagtggtcggtcgtagatccacaggatattgac
gatgacaaataccagtttgcgaaaaagttctccgagttgctctgctccctgggcaactat
ctggacagaaagttcgcggctataccaccccagactaacgtccaaggatttctcgagcta
ctcatgctggtggtgcaaagccagagccttgtcgtttcaattccagtccttctcacgtgg
acgcgcttgctgtctcatcggtctcttggtcccgcagctgccgagatgcccttgattgtc
aacctcttggaggtgtgctgcgctcgcttgattcgatacgagagctttcccgaagattcg
gaagaccctgtttacgttttacttatcgaagataccgacactattcccgaacgacatgct
tttctcggcaactaccgacggtattgctgctccattattgagagcatcgtccatctcaag
atgtcagatgcattctcgcatatactgggcagggcggagcgtgctttgaatacgctgtat
gatgggcagcctcccctaaatcctgctaactattctaaatcctcgttgcccgttttgacg
tttgatgcccatgcaactgtgattgaggctgcgctcaaaggctacgacaagtggagggcg
tcacgcagccggaccaatgaggagaagcagcaagcaaccgcggtcgaggagtattttgag
aaatggtgtggtcaactccttgaaatgaaatttgaggatcctctaatccgcaagcggata
cttcagctcctggtgaccttctctaccagagcactggattctaatcctgcgtttatgcta
agagtcctggagcatatcctgatgacatggccggctctgcaaccagaacacaggctctac
aatgacgccatcagagatctccagactgaaagcatggttgagcttcaacggttggcatca
aaaatgccggacccactccttgacgtgtatgatcagctagaggcgaaggtccaggagatg
atcgcgtcgggaaccctggacgaaaagcgccagatcgcataccaaagtttcttgttcatc
atcgttcaccgggctacgcatattgacccggccgtacggctctcaaagctcactgcattt
atcgaccctgttaaggaccagtggaaaaatgagtccttaaaagcggccctgggttcttac
aacggtttctgcgagctgctaggtctagacaaagtgcaaaagtacctaactgagcgccgt
gtgcacgagaacgccgactggggctctaccgatcttgacgctgaaggcctcgcactacag
gctgaactggaacaccgacagtcggtcctcccgcttcgggtgaccaagtccttcttaaca
tactcggtggagcgaatagaaaaggactcggctccctaccaggcatcttgcactctctgg
caggatggattccagctcatcctgccagagcttctcaaacttttaagctacgcccacgca
tcccacaacccagccaactgggttttgctgccagcagaaatgcagccaacagtgggtcgc
ctcctgtccgaccgattctggcaagccggcatttcggaagggagcaaggatgatttctat
gctagagtgcttgggaagaagaacactctggaagggctcgcgtcaactgtccgtggcacg
attcggttcgtgcgcgagacgtgctacgccatcatttactgcatgacgcggttgaacacg
cagttctacggcttccttgaactgccaggtcccttggcgaacgcgttgttcgcggattct
gtctacctgtcatctcaccaggtcatcaaccttctcaccctggtcaggtttctagtcgac
aactgtcctgcggaattacgggagcacttcgtcccccccatcttggcagcctgctttgaa
cagatggatgcgaagatcagctctgagtgggaaaagctcggacaacgagaagcagtacaa
gcggcaggagatgaattgaccgaggagatgaaggccgagagcatactgagacaactcacg
tattccgccgtactaatggtcgctgacgtcctcgatccagccagagtcgcagccccgtca
gcctctgaagaacagcccgtcgacgcagcctcgagcgcgaaatacccgccgctgcgaaag
ttttgcttgatgaacccgtccatcgctgttccgctgctggtcttctgcagccacgcgatc
cggatgcatgatggtagatcctgcggcgtggtgctgcgggtcttccgttccattattccc
gaattcagcccttcggaagtcccgaggacaatgaaagattcaggccatacggagcccctc
gaggattttccgatcccggaggagacggcaagagacatcagagagttcatctccacggag
gtgctgaaggcggccatttcttccctgcacgacccctatttcgtggacttgcaacgggag
ttgggcgcgctcatcgcccaaattttggcttactatgcttccctgacgcccacacctcgg
aatatccttgtttccttgccaaatatcaaaccagaggatgttgaccgtacgattcagcaa
gtgtcccagaccgggatgcactctcgacagcaacgcgctctcgttctcgaactactagag
gacttgaagggagtcagcatctctgagatgggtaagctgactaagagtttcggggcaaga
ccgggatcggcgcgcggcaacaagaagtctgcccggagcaagatggctcaagaattcatg
acgccacaagcaggctcgggaggaggtggaaggaggacagatggggatggctcagcggca
cgtaacaagactccagacttggaaggtatggcggggatgttcaacgaggccgagtag

DBGET integrated database retrieval system