KEGG   Thermothelomyces thermophila: MYCTH_2313137Help
Entry
MYCTH_2313137     CDS       T02231                                 

Definition
(RefSeq) glycoside hydrolase family 27 protein
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
mtm  Thermothelomyces thermophila
Pathway
mtm00052  Galactose metabolism
mtm00561  Glycerolipid metabolism
mtm00600  Sphingolipid metabolism
mtm00603  Glycosphingolipid biosynthesis - globo and isoglobo series
mtm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MYCTH_2313137
  Lipid metabolism
   00561 Glycerolipid metabolism
    MYCTH_2313137
   00600 Sphingolipid metabolism
    MYCTH_2313137
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    MYCTH_2313137
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     MYCTH_2313137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase_2 Melibiase
Motif
Other DBs
NCBI-GeneID: 11510076
NCBI-ProteinID: XP_003667369
JGI: 2313137
UniProt: G2QNU8
Position
7:complement(join(3850782..3851379,3851496..3851702,3851792..3852035,3852165..3852258,3852365..3852472))
Genome map
AA seq 416 aa AA seqDB search
MKYARNSFLVALYWPRVAKALDNGVGLTPHMGWSSWNVAQCDAASAKYALDTAEKFISLG
LKDLGYEYINIDDCWSLKSRDENGKLVPDPGKWPDGIKPVADRIHDLGLKFGLYGCAGQK
TCAGYPGSDGDKYAASDVSQLVEWGVDFWKYDNCYTPCLDNPPPQTCQRPAGNSQEWYAP
MRDAILGVQETRKIHFNLCNWGRDDVWGWGDDYGHSWRMSVDNWGDWESVERIGSAAADI
AEYSGPGGFNDLDMLYLGSPKLNANEERLHFGLWAIAKSPLVLGLDLATISNATLDIIRN
KGIIDINQDRLGKAATTFTPPGRPGPESESGRIYPYWAGPLSDGVVIGLCAGSSAGTYAV
DFRDVPGLGDGSYSWEEMYTGQTGTGTGVSFDIDLHDMRVIKVKTAGTKGGRAAEL
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacgcgcgcaacagtttcctcgtggccctgtattggccgcgagtcgccaaggcc
ttggataatggggtcggcttgacgcctcacatgggatggagcagctggaatgtcgcccag
tgcgatgctgcctcggccaagtatgccctcgacacggccgagaagtttatttcgctcggg
ctcaaggacctcgggtacgaatacatcaacattgacgactgctggtcgctcaagtctcgc
gacgagaacgggaagcttgtgcccgatccgggcaaatggcccgacggcatcaaacccgtc
gccgatcggatccacgacctggggctcaagtttggtctgtacggctgtgccggccagaag
acctgcgccggttaccccgggagcgacggggataagtacgcggcctcggatgtctctcag
ctggtcgagtggggagtcgatttttggaagtatgacaactgctacaccccctgcttggac
aacccaccgccgcaaacctgccagagaccggcgggaaacagccaagagtggtacgccccg
atgcgggatgccatcctgggcgtccaggagacgcgcaagatccacttcaacctctgcaac
tggggacgtgacgacgtctgggggtggggcgatgactacggacactcgtggcggatgagc
gtcgacaactggggagactgggagagcgtcgagcggatcggcagcgcggcggccgacatt
gccgagtacagcgggccgggcgggttcaacgacctcgacatgctgtacctcgggtcgccg
aagcttaacgccaacgaggagcgcctccacttcggcctctgggccatcgccaagtcgccc
ctcgtgctggggctcgacctcgccaccatctcgaacgcgacgctcgacatcattcgcaac
aagggcatcatcgacatcaaccaggacaggctgggcaaggccgctaccaccttcaccccg
cccggccggcccggcccggagagcgagagcggcaggatctacccgtactgggccggcccg
ctcagcgacggcgtcgtcatcggcctctgcgccggctcctcggcggggacctacgccgtc
gacttcagggacgtcccgggcctcggggacggcagctactcgtgggaggagatgtacacg
ggccagaccggcaccggcaccggcgtctcgttcgacattgacctccacgacatgcgggtc
atcaaggtgaagacggcgggcacgaaaggaggacgggcggcagaactttga

DBGET integrated database retrieval system