KEGG   Thermothelomyces thermophilus: MYCTH_75824Help
Entry
MYCTH_75824       CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mtm  Thermothelomyces thermophilus
Pathway
mtm03040  Spliceosome
mtm04141  Protein processing in endoplasmic reticulum
mtm04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mtm00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    MYCTH_75824
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    MYCTH_75824
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    MYCTH_75824
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mtm01009]
    MYCTH_75824
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mtm03041]
    MYCTH_75824
   03009 Ribosome biogenesis [BR:mtm03009]
    MYCTH_75824
   03110 Chaperones and folding catalysts [BR:mtm03110]
    MYCTH_75824
   04131 Membrane trafficking [BR:mtm04131]
    MYCTH_75824
   03051 Proteasome [BR:mtm03051]
    MYCTH_75824
   03029 Mitochondrial biogenesis [BR:mtm03029]
    MYCTH_75824
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtm04147]
    MYCTH_75824
Protein phosphatases and associated proteins [BR:mtm01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     MYCTH_75824
Spliceosome [BR:mtm03041]
 Complex B
  Other components
   Prp19 complex
    MYCTH_75824
 Complex C
   Prp19-CDC5 complex
    MYCTH_75824
Ribosome biogenesis [BR:mtm03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    MYCTH_75824
Chaperones and folding catalysts [BR:mtm03110]
 Heat shock proteins
  HSP70 / DNAK
   MYCTH_75824
Membrane trafficking [BR:mtm04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    MYCTH_75824
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    MYCTH_75824
Proteasome [BR:mtm03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    MYCTH_75824
Mitochondrial biogenesis [BR:mtm03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    MYCTH_75824
Exosome [BR:mtm04147]
 Exosomal proteins
  Proteins found in most exosomes
   MYCTH_75824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR
Motif
Other DBs
NCBI-GeneID: 11505545
NCBI-ProteinID: XP_003658595
JGI: 75824
UniProt: G2Q1R6
Position
1:complement(join(1311376..1311644,1311707..1312516,1312583..1312961,1313023..1313191,1313254..1313431,1313543..1313585))
Genome map
AA seq 615 aa AA seqDB search
MADEVYDGAIGIDLGTTYSCVATYEGTNVEIIANEQGSFTTPSFVSFTEDERLIGEAAKN
QAAMNPANTVFDVKRLIGRRFDDPTVKKDMESWPFKVVDDGNGNPKVEVQYLGTTHTFSP
QEISAMVLSKMKEIAETKLGKKVEKAVITVPAYFNDNQRQATKDAGAIAGLNVLRIINEP
TAAAIAYGLGSGKSSKERNVLIYDLGGGTFDVSLLNIQGGVFTVKATAGDTHLGGQDFDT
NLLDYCKKEFTRKTKKDLSGDSRALRRLRTACERAKRTLSSGAQTTIEIDSLFDGEDFNM
QITRARFEDLNAKAFAGTLEPVAQVLKDANIEKSAVDEIVLVGGSTRIPRIQKLLSEFFD
GKKLEKSINPDEAVAYGAAVQAGILSGKATSADTSDLLLLDVVPLSLGVAMEGNIFAPVV
PRGQTVPTIKKRTFTTVADNQQTVQFPVYQGERVNCEDNTSLGEFTLAPIPPMKAGEPVL
EVVFEVDVNGILKVTATEKTSGRSANITITNSVGKLSSSEIESMINDAEKFKSKDEAFSK
RFEAKQQLESYISRVEEIISDPTLSLKLKRGQKDKIEQSLSEAMAQLEIEDSTAEDLKKK
ELALKRLVTKAMSSR
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgaagtctatgacggtgccattggcatcgatctcggcaccacctactcctgc
gttgctacgtacgagggtaccaatgtcgagatcatcgccaacgagcagggtagcttcacc
acgccctcgttcgtctccttcactgaggacgagcgcctgattggtgaggcggccaagaac
caggccgccatgaacccggcgaacaccgtcttcgatgtcaagcgtctgatcggtcgccgc
ttcgatgaccccaccgtcaagaaggacatggagtcgtggcccttcaaggtcgtggatgac
ggcaacggcaaccccaaggtcgaggtccagtaccttggcaccacccacaccttctccccc
caggagatctcggctatggtcctcagcaagatgaaggagattgccgagaccaagctcggt
aagaaggttgagaaggccgtcatcaccgtgccggcctacttcaacgacaaccaaagacag
gccaccaaggatgctggtgccatcgctggcctgaacgtcctccgtatcatcaacgagcct
acggctgccgccatcgcctacggtcttggctctggcaagtccagcaaggagcgcaacgtg
ctcatctacgatctcggtggtggtactttcgatgtgtcgctcctgaacatccagggcggt
gtcttcaccgtcaaggctaccgctggtgacacccacctcggtggccaggactttgacacc
aaccttttggattactgcaagaaggaattcacgaggaaaactaagaaagacctctcgggc
gattctcgtgccctccgccggctgaggactgcctgcgagcgcgccaagcgcactctgtcg
agcggtgctcagaccaccattgagatcgactctctgttcgatggcgaggacttcaacatg
cagatcactcgtgcccgtttcgaggatctgaacgccaaggccttcgctggtaccctggag
cctgttgcccaggttctcaaggacgccaacatcgagaagagcgcggtcgacgagatcgtc
cttgtcggtggctcgacccgtattccccgcatccagaagctcctcagcgagttcttcgac
ggcaagaagcttgagaagagcatcaaccccgatgaggccgttgcctacggtgccgccgtc
caggccggtatcctctctggcaaggccacctctgccgacacctcggacctccttctgctg
gatgtcgttcctctgtctctgggtgttgccatggagggcaacatcttcgcccccgtcgtc
ccccgtggccagaccgtccccaccatcaagaagaggacgttcaccacggttgccgacaac
cagcagaccgtccagttccctgtgtaccagggtgagcgtgtcaactgcgaggacaacacc
tctctgggtgaattcacccttgctcccatccctcccatgaaggctggcgagcccgtcctc
gaggtcgtcttcgaggttgatgtcaacggtatcctcaaggtgacggctaccgagaagacc
tctggccgcagcgccaacatcaccatcaccaactctgttggcaagctctcgtcgagcgag
atcgagagcatgatcaacgatgccgagaagttcaagtccaaggatgaggctttcagcaag
cgcttcgaggccaagcagcagctcgagtcgtacatctcgcgtgttgaggagatcatctcg
gacccgacactgtcgctcaagctcaagcgtggccagaaggacaagattgagcagtcgctg
agcgaggccatggcccagctcgagattgaggactccacggccgaggacctgaagaagaag
gagcttgctctcaagaggctggtcaccaaggccatgtcttcgcgttaa

DBGET integrated database retrieval system