KEGG   Mycobacterium tuberculosis Erdman = ATCC 35801: ERDMAN_0272Help
Entry
ERDMAN_0272       CDS       T02526                                 

Gene name
fadA2
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtn  Mycobacterium tuberculosis Erdman = ATCC 35801
Pathway
mtn00071  Fatty acid degradation
mtn00072  Synthesis and degradation of ketone bodies
mtn00280  Valine, leucine and isoleucine degradation
mtn00310  Lysine degradation
mtn00362  Benzoate degradation
mtn00380  Tryptophan metabolism
mtn00620  Pyruvate metabolism
mtn00630  Glyoxylate and dicarboxylate metabolism
mtn00640  Propanoate metabolism
mtn00650  Butanoate metabolism
mtn00900  Terpenoid backbone biosynthesis
mtn01100  Metabolic pathways
mtn01110  Biosynthesis of secondary metabolites
mtn01120  Microbial metabolism in diverse environments
mtn01130  Biosynthesis of antibiotics
mtn01200  Carbon metabolism
mtn01212  Fatty acid metabolism
mtn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mtn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ERDMAN_0272 (fadA2)
   00630 Glyoxylate and dicarboxylate metabolism
    ERDMAN_0272 (fadA2)
   00640 Propanoate metabolism
    ERDMAN_0272 (fadA2)
   00650 Butanoate metabolism
    ERDMAN_0272 (fadA2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ERDMAN_0272 (fadA2)
   00072 Synthesis and degradation of ketone bodies
    ERDMAN_0272 (fadA2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ERDMAN_0272 (fadA2)
   00310 Lysine degradation
    ERDMAN_0272 (fadA2)
   00380 Tryptophan metabolism
    ERDMAN_0272 (fadA2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ERDMAN_0272 (fadA2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ERDMAN_0272 (fadA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ERDMAN_0272 (fadA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtn04147]
    ERDMAN_0272 (fadA2)
Enzymes [BR:mtn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ERDMAN_0272 (fadA2)
Exosome [BR:mtn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ERDMAN_0272 (fadA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAL64089
UniProt: A0A0H3L4Z7
Position
291486..292808
Genome map
AA seq 440 aa AA seqDB search
MAPAAKNTSQTRRRVAVLGGNRIPFARSDGAYADASNQDMFTAALSGLVDRFGLAGERLD
MVVGGAVLKHSRDFNLMRECVLGSELSPYTPAFDLQQACGTGLQAAIAAADGIAAGRYEV
AAAGGVDTTSDPPIGLGDDLRRTLLKLRRSRSNVQRLKLVGTLPASLGVEIPANSEPRTG
LSMGEHAAVTAKQMGIKRVDQDELAAASHRNMADAYDRGFFDDLVSPFLGLYRDDNLRPN
SSVEKLATLRPVFGVKAGDATMTAGNSTPLTDGASVALLASEQWAEAHSLAPLAYLVDAE
TAAVDYVNGNDGLLMAPTYAVPRLLARNGLSLQDFDFYEIHEAFASVVLAHLAAWESEEY
CKRRLGLDAALGSIDRSKLNVNGSSLAAGHPFAATGGRILAQTAKQLAEKKAAKKGGGPL
RGLISICAAGGQGVAAILEA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtggcccctgctgctaagaacacttcacagaccaggcggcgagtcgccgtactgggcggc
aaccgcatcccgttcgccagatcggacggtgcctacgcggatgcgtccaaccaggacatg
ttcaccgcggcgctgagcggcttggtggaccgattcggactcgccggcgagcggctggac
atggtggtgggcggtgcggtgctcaaacacagccgcgacttcaatctaatgcgcgaatgc
gtgctgggctccgaactctcgccgtacacgccggcgttcgacctgcagcaggcctgcggg
acgggcctgcaggccgcgatcgcggccgccgacggcattgccgccgggcggtatgaggtg
gccgccgctggcggggtggacaccacctcggacccgccgatcggcctgggcgacgacctg
cgccgcaccctgctcaagctgcgccgatctaggtccaacgtgcaacgcctcaagctggtg
ggcacgctgccggccagcctgggcgtggagatccccgccaacagcgagccgcgcaccggg
ctgtcgatgggcgagcacgccgccgtcaccgccaagcagatgggcatcaaacgcgtagac
caggacgagctggccgccgccagccatcgcaatatggccgacgcctacgaccggggtttc
ttcgacgacctggtcagtccgtttttagggctgtaccgagacgacaatctgcggcctaac
tccagcgtcgagaaactggccacgctgcgtccggtcttcggagtgaaggccggtgacgcg
acgatgacggccggcaattcgactccgctgaccgacggcgcctcggtggcattgctggcc
agcgaacagtgggcggaggcacactcgctggctccgctggcctatctcgtggatgccgag
accgccgcggtcgactatgtcaacggcaacgacggcctgttgatggcgccgacctacgcg
gtaccccggctgctggcccgtaacgggttgagcctgcaggacttcgacttctacgaaatc
cacgaggcgtttgcctccgtggtgctcgcgcatctggcggcgtgggagtccgaggagtac
tgcaagcggcggctgggcctggacgccgcgctggggtcgatcgatcggtccaagctcaac
gtcaacgggtcgtcgttggccgccgggcaccccttcgcggcgaccggtgggcggattttg
gcgcagaccgccaagcagctcgccgagaagaaggcggcgaaaaaaggcggcggaccgctg
cgcgggctgatttcgatctgcgcggccggcggccaaggtgtggccgcgattttggaggcc
tga

DBGET integrated database retrieval system