KEGG   Mycobacterium tuberculosis Erdman = ATCC 35801: ERDMAN_1028Help
Entry
ERDMAN_1028       CDS       T02526                                 

Definition
(GenBank) short chain dehydrogenase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
mtn  Mycobacterium tuberculosis Erdman = ATCC 35801
Pathway
mtn00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:mtn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    ERDMAN_1028
Enzymes [BR:mtn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     ERDMAN_1028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR 3HCDH_N NAD_binding_7 Sacchrp_dh_NADP Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: BAL64834
UniProt: A0A0H3LDM5
Position
complement(1031335..1032126)
Genome map
AA seq 263 aa AA seqDB search
MILDMFRLDDKVAVITGGGRGLGAAIALAFAQAGADVLIASRTSSELDAVAEQIRAAGRR
AHTVAADLAHPEVTAQLAGQAVGAFGKLDIVVNNVGGTMPNTLLSTSTKDLADAFAFNVG
TAHALTVAAVPLMLEHSGGGSVINISSTMGRLAARGFAAYGTAKAALAHYTRLAALDLCP
RVRVNAIAPGSILTSALEVVAANDELRAPMEQATPLRRLGDPVDIAAAAVYLASPAGSFL
TGKTLEVDGGLTFPNLDLPIPDL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgatcctggatatgttccgtcttgacgacaaggttgccgtcatcaccggcggcggccgc
ggcctgggagcagccatcgcattggctttcgcccaggccggcgcggatgtcctcatcgct
tcacgaacatcatccgagcttgacgctgtcgccgaacagatccgcgctgccggccgccgc
gcccacaccgttgccgccgatctggcccatcccgaggtgaccgcgcagctggctggtcag
gccgtcggagctttcgggaagctcgacatcgtcgtcaacaacgttggcggcaccatgccc
aacacgctgctaagcacctcgaccaaggacctcgcggacgccttcgccttcaacgtgggc
accgcccacgcgctgaccgtcgcggcggtgccgttgatgctggaacactccggcggcggc
agcgtgatcaacatcagctccaccatgggccggctggcggcgcggggtttcgccgcctac
ggcaccgccaaggccgcactggcccactacacccggctggcggcgctggacctgtgccca
cgcgtccgggtcaatgcgatcgcgccgggttccatcctgacctcggcgctggaggtggta
gccgccaacgacgagctgcgtgcgccgatggagcaggcgacaccactgcgccggctcggt
gaccccgtcgacattgcagctgcggcagtgtatttggcctctccggcgggcagcttcctg
accggcaagacgttggaggtcgacggcggactcaccttccccaatctcgaccttcccatt
ccggacctgtga

DBGET integrated database retrieval system