KEGG   Mycobacterium tuberculosis CTRI-2: MTCTRI2_0666Help
Entry
MTCTRI2_0666      CDS       T01993                                 

Definition
(GenBank) sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mto  Mycobacterium tuberculosis CTRI-2
Pathway
mto00010  Glycolysis / Gluconeogenesis
mto00052  Galactose metabolism
mto00500  Starch and sucrose metabolism
mto00520  Amino sugar and nucleotide sugar metabolism
mto00521  Streptomycin biosynthesis
mto01100  Metabolic pathways
mto01110  Biosynthesis of secondary metabolites
mto01120  Microbial metabolism in diverse environments
mto01130  Biosynthesis of antibiotics
mto01200  Carbon metabolism
Module
mto_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mto_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mto00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTCTRI2_0666
   00052 Galactose metabolism
    MTCTRI2_0666
   00500 Starch and sucrose metabolism
    MTCTRI2_0666
   00520 Amino sugar and nucleotide sugar metabolism
    MTCTRI2_0666
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MTCTRI2_0666
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MTCTRI2_0666
Enzymes [BR:mto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MTCTRI2_0666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AEM99105
Position
747225..748133
Genome map
AA seq 302 aa AA seqDB search
MLTLCLDIGGTKIAAGLADPAGTLVHTAQRPTPAYGGAEQVWAAVAEMIADALGVAGGAV
GGVGIASAGPIDLHSGRVSPINIGSWGGFPLRDRVAAAVPGVPVRLGGDGVCMALGEHWL
GAGRGARFLLGLVVSTGVGGGLVLDGAPCLGRTGNAGHVGHVVVDPDGSPCPCGGRGCVE
TIASGPSLARWARANGWSAPPGAGAKELAEAAGAGDPVALRAFRRGAAALAAMIASVGAV
CDLDLAVIGGGVAKSGRLLFEPLRAALADHARLDFLAGLRVVPAELGGAAGLVGAARLAA
IA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccctttgcctcgacatcggcggcaccaagatcgccgcgggcctggccgacccg
gccggcacgttggtgcacaccgcccaacgtcccaccccggcgtatggcggagccgaacag
gtctgggccgcggtcgccgagatgatcgccgacgcgctcggcgtggcggggggcgcggtc
ggtggtgtggggatcgcctcggccggtcctatcgacctacacagcggccgcgtcagcccg
atcaacatcggatcctggggcggctttccgctgcgggatcgggtcgccgccgcggtcccg
ggggttccggtgcggctggggggtgacggggtgtgcatggcgctcggcgagcactggctg
ggagccggacggggtgcgcgctttctgttgggtttggtggtgtccaccggggtgggcggc
gggttggtgctcgacggcgccccctgtctcggccgcaccggcaacgccggtcacgtcggc
cacgtggtggtggatccggatggctcgccgtgcccgtgcggggggcgtggctgtgtggag
accatcgcgtccggcccgtcgctggcgcgctgggcgcgggccaacggctggtccgcgccg
cccggggccggcgccaaagagctggccgaggcggctggggccggagacccggtggcgctg
cgggccttccgccgcggcgccgcggcgctggccgcgatgatcgcctcggtgggcgccgtg
tgcgacttggatctcgccgtcatcggcggcggcgtggccaagtcgggtcgcctgctgttc
gagccgttacgtgcggcgctagccgaccacgcccggctggactttctggccggcctgcgg
gtggtgcctgccgagctgggcggcgccgccggcctggtgggtgcggccaggctcgcggcc
atcgcataa

DBGET integrated database retrieval system