KEGG   Mycobacterium tuberculosis CTRI-2: MTCTRI2_0882Help
Entry
MTCTRI2_0882      CDS       T01993                                 

Gene name
fadA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mto  Mycobacterium tuberculosis CTRI-2
Pathway
mto00071  Fatty acid degradation
mto00072  Synthesis and degradation of ketone bodies
mto00280  Valine, leucine and isoleucine degradation
mto00310  Lysine degradation
mto00362  Benzoate degradation
mto00380  Tryptophan metabolism
mto00650  Butanoate metabolism
mto00900  Terpenoid backbone biosynthesis
mto01100  Metabolic pathways
mto01110  Biosynthesis of secondary metabolites
mto01120  Microbial metabolism in diverse environments
mto01130  Biosynthesis of antibiotics
mto01200  Carbon metabolism
mto01212  Fatty acid metabolism
mto02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MTCTRI2_0882 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    MTCTRI2_0882 (fadA)
   00640 Propanoate metabolism
    MTCTRI2_0882 (fadA)
   00650 Butanoate metabolism
    MTCTRI2_0882 (fadA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MTCTRI2_0882 (fadA)
   00072 Synthesis and degradation of ketone bodies
    MTCTRI2_0882 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MTCTRI2_0882 (fadA)
   00310 Lysine degradation
    MTCTRI2_0882 (fadA)
   00380 Tryptophan metabolism
    MTCTRI2_0882 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MTCTRI2_0882 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MTCTRI2_0882 (fadA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MTCTRI2_0882 (fadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mto04147]
    MTCTRI2_0882 (fadA)
Enzymes [BR:mto01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MTCTRI2_0882 (fadA)
Exosome [BR:mto04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MTCTRI2_0882 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AEM99316
Structure
PDB: 

Position
955431..956642
Genome map
AA seq 403 aa AA seqDB search
MSEEAFIYEAIRTPRGKQKNGSLHEVKPLSLVVGLIDELRKRHPDLDENLISDVILGCVS
PVGDQGGDIARAAVLASGMPVTSGGVQLNRFCASGLEAVNTAAQKVRSGWDDLVLAGGVE
SMSRVPMGSDGGAMGLDPATNYDVMFVPQGIGADLIATIEGFSREDVDAYALRSQQKAAE
AWSGGYFAKSVVPVRDQNGLLILDHDEHMRPDTTKEGLAKLKPAFEGLAALGGFDDVALQ
KYHWVEKINHVHTGGNSSGIVDGAALVMIGSAAAGKLQGLTPRARIVATATSGADPVIML
TGPTPATRKVLDRAGLTVDDIDLFELNEAFASVVLKFQKDLNIPDEKLNVNGGAIAMGHP
LGATGAMILGTMVDELERRNARRALITLCIGGGMGVATIIERV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagaagccttcatctacgaggccatccgcaccccgcgcggcaaacaaaagaac
ggatcgttgcacgaagtcaagccattgagcctggtcgtcggcctgatcgacgagctgcgc
aagcgccatcccgacctcgacgagaacctgatcagcgacgtcatcttgggctgcgtctca
ccggtgggcgaccagggcggcgacatcgcccgcgccgcagtgctggcatcgggcatgccg
gtcacctccggcggtgtgcagctcaaccggttctgcgcgtccggcctggaggccgtcaac
accgccgcgcagaaggtgcgttcgggctgggatgacctggtgctggccggcggcgtggag
tcgatgagccgggtgccgatgggctccgacggcggcgctatgggcctggacccggcgacc
aactacgacgtcatgttcgtcccgcagggcatcggcgccgacctgatcgccaccatcgag
ggcttctcccgcgaagacgtcgacgcctacgcgctacgcagccagcaaaaggccgccgag
gcgtggtcgggcggctacttcgccaagtcggtggtgccggtgcgcgaccagaacggcctg
ctgatcctcgatcatgacgaacacatgcggccggacaccaccaaggagggtctggccaag
ctgaagccggccttcgaaggcctggccgcgctgggcggtttcgacgacgtggcgctgcag
aagtaccactgggtggaaaagatcaaccacgtacacaccggcggcaacagctcggggatc
gtcgacggtgccgcgctggtgatgatcggttccgcggccgccggcaagttgcagggcctg
actccgcgggcgcgcatcgtcgccaccgccaccagcggcgccgacccggtgatcatgctc
accggccccaccccggccacccgcaaggtgctcgaccgcgccgggctgaccgtcgacgac
atcgacctgttcgagctcaacgaggcgttcgcgtcggtggtgctgaagttccagaaggac
ctcaacattcccgacgagaagctcaacgtcaacggtggcgccatcgcgatgggccacccg
ctgggtgccaccggcgcgatgatcctgggcaccatggtcgacgaactggagcgccgcaac
gcccgacgtgcactcatcacgctgtgcatcgggggcggcatgggtgtcgcgacgatcatc
gagagggtttaa

DBGET integrated database retrieval system