KEGG   Mycobacterium tuberculosis CTRI-2: MTCTRI2_1375Help
Entry
MTCTRI2_1375      CDS       T01993                                 

Gene name
murI
Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
mto  Mycobacterium tuberculosis CTRI-2
Pathway
mto00471  D-Glutamine and D-glutamate metabolism
mto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mto00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    MTCTRI2_1375 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mto01011]
    MTCTRI2_1375 (murI)
Enzymes [BR:mto01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     MTCTRI2_1375 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:mto01011]
 Precursor biosynthesis
  Racemase
   MTCTRI2_1375 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AEM99799
Structure
PDB: 

Position
1505382..1506197
Genome map
AA seq 271 aa AA seqDB search
MNSPLAPVGVFDSGVGGLTVARAIIDQLPDEDIVYVGDTGNGPYGPLTIPEIRAHALAIG
DDLVGRGVKALVIACNSASSACLRDARERYQVPVVEVILPAVRRAVAATRNGRIGVIGTR
ATITSHAYQDAFAAARDTEITAVACPRFVDFVERGVTSGRQVLGLAQGYLEPLQRAEVDT
LVLGCTHYPLLSGLIQLAMGENVTLVSSAEETAKEVVRVLTEIDLLRPHDAPPATRIFEA
TGDPEAFTKLAARFLGPVLGGVQPVHPSRIH
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaattcgccgttggcgcccgtcggagtctttgattccggcgtcgggggactgacggtc
gcgcgggccatcatcgaccaactgcccgacgaggacatcgtctacgtcggcgacaccggt
aacggcccgtacggtccgctgaccatcccggagatccgggcgcacgcgctggccatcggc
gacgatctggtcggccgaggcgtcaaggcgttggtgatcgcctgcaactcggcgtcgtcg
gcgtgcctgcgggatgctcgcgagcgctaccaggtgcccgtcgtcgaagtgatactgccg
gcggtgcggcgtgcggtggccgccacccgcaacggccgcatcggggtaatcggcacgcgg
gcgaccatcacttcacacgcctatcaggacgcgttcgctgcggcccgcgacaccgaaatc
accgcggtggcttgccctcgcttcgtggacttcgtcgagcgcggcgtcaccagcggtcgt
caggtgctcggtctggcgcagggctacctggaaccgctgcagcgcgccgaggtcgacacg
ctagtgctgggctgtacgcactatccactgctgtccggactgattcaactggcgatgggc
gagaacgtcacgctggtctccagcgccgaggagaccgctaaggaagtggtccgggtgctc
accgagatcgacttattgcgtccgcatgacgcgccgccggcaactcggatatttgaagct
acgggcgaccccgaagcgtttaccaaattggccgcacgattcctgggtccggtgctcggt
ggtgtgcaacccgttcacccatcgcgcattcattag

DBGET integrated database retrieval system