KEGG   Mycobacterium tuberculosis CTRI-2: MTCTRI2_2437Help
Entry
MTCTRI2_2437      CDS       T01993                                 

Gene name
ggtB
Definition
(GenBank) gamma-glutamyltranspeptidase precursor GgtB
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
mto  Mycobacterium tuberculosis CTRI-2
Pathway
mto00430  Taurine and hypotaurine metabolism
mto00460  Cyanoamino acid metabolism
mto00480  Glutathione metabolism
mto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mto00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    MTCTRI2_2437 (ggtB)
   00460 Cyanoamino acid metabolism
    MTCTRI2_2437 (ggtB)
   00480 Glutathione metabolism
    MTCTRI2_2437 (ggtB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mto01002]
    MTCTRI2_2437 (ggtB)
Enzymes [BR:mto01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     MTCTRI2_2437 (ggtB)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     MTCTRI2_2437 (ggtB)
Peptidases and inhibitors [BR:mto01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   MTCTRI2_2437 (ggtB)
CD molecules [BR:mto04090]
 Proteins
  MTCTRI2_2437 (ggtB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AEN00852
Position
2684296..2686227
Genome map
AA seq 643 aa AA seqDB search
MSVWLRAGALVAAVMLSLSGCGGFHAGAPSTAGPCEIVPNGTPAPKTPPATVPSSRNLAT
NPEIATGYRRDMTVVRTAHYAAATANPLATQVACRVLRDGGTAADAVVAAQAVLGLVEPQ
SSGIGGGGYLVYFDARTGSVQAYDGREVAPAAATENYLRWVSDVDRSAPRPNARASGRSI
GVPGILRMLEMVHNEHGRTPWRDLFGPAVTLADGGFDISARMGAAISDAAPQLRDDPEAR
KYFLNPDGSPKPAGTRLTNPAYSKTLSAIASAGANAFYSGDIAHDIVAAASDTSNGRTPG
LLTIEDLAGYLAKRRQPLCTTYRGREICGMPSSGGVAVAATLGILEHFPMSDYAPSKVDL
NGGRPTVMGVHLIAEAERLAYADRDQYIADVDFVRLPGGSLTTLVDPGYLAARAALISPQ
HSMGSARPGDFGAPTAVAPPVPEHGTSHLSVVDSYGNAATLTTTVESSFGSYHLVDGFIL
NNQLSDFSAEPHATDGSPVANRVEPGKRPRSSMAPTLVFDHSSAGRGALYAVLGSPGGSM
IIQFVVKTLVAMLDWGLNPQQAVSLVDFGAANSPHTNLGGENPEINTSDDGDHDPLVQGL
RALGHRVNLAEQSSGLSAITRSEAGWAGGADPRREGAVMGDDA
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgtttggttgcgagcgggcgccttggtggctgcagtgatgctgtcgctgagcgga
tgtggcggcttccacgcgggtgcgccaagcacggccggtccgtgcgagatcgtccccaat
ggcacgccggcgcccaagacacccccggctaccgtgccttcgtcgcgcaacctcgcgacc
aaccccgagatcgccaccggctaccgccgggacatgaccgtggtgcggaccgcccactat
gcggcagccaccgccaatccgctggccactcaggtggcctgccgagtattgcgcgacggt
ggtaccgccgccgatgccgtcgtggccgcccaggcggtgctggggttggtcgaaccgcaa
tcctccgggatcggcggcggcggatatctggtgtacttcgacgcccgcacgggctcagtg
caggcctacgacggccgtgaggtggccccagcggccgccaccgagaactaccttcgctgg
gtcagcgacgtcgaccgcagcgcgcccaggcccaacgcccgagcctcgggacggtcgatc
ggagtaccgggcatcctgcgaatgctggagatggtgcacaacgagcacgggcgcacaccc
tggcgcgacctcttcggccccgcggtaacgctggccgatggcggttttgacatcagcgcc
aggatgggcgcggccatctccgacgctgcgccgcaactgcgagacgacccggaggctcgc
aagtatttcctcaatcccgacggcagcccgaaacccgcgggaacccggctgacgaacccc
gcgtactcaaaaaccctgtccgccatcgcctccgccggcgccaacgccttctattccggc
gacattgcccacgacatcgtggcggcggcgagcgacacatcgaatggccgcacgccgggc
ctgttgaccattgaggacctggcgggttacctcgccaagagacgccaaccgttgtgcacg
acctatcgcggccgggagatctgcggcatgccatcgtcgggtggcgtcgccgtggccgca
accttgggcatcctcgagcacttcccgatgagcgactacgcgcccagcaaggtcgacctc
aacggcggtcgcccgaccgtgatgggggttcacctgatagcggaggccgaacggctggcc
tatgccgaccgcgaccaatatatcgctgacgtcgattttgtccggctgcccggcggctcg
ctcaccacgctggttgacccgggctacttggcagcacgcgccgcgctaatctcgccgcaa
cacagcatgggcagcgccagaccgggggacttcggcgcaccgacggccgtcgccccgcca
gtgcctgagcatggcaccagccacctcagcgtcgtcgattcgtacggcaatgcggccacg
ttgacgacgacggtggaatcttcgttcggctcctaccacctggtggacggattcatcctc
aacaaccagctgagcgatttcagcgccgagccacacgctactgacggatcaccggtggct
aaccgggtcgagcctgggaagcgaccgcgcagttcgatggcaccgacgttggtgttcgat
cactcgtcggcggggcgcggtgcgctgtacgcggtgctcggttctccgggcggctccatg
atcatccagttcgtcgtgaaaacacttgtggcgatgctggattggggtctgaatccgcag
caggcggtttccctggtcgatttcggcgccgcgaactcgccgcacactaacctcggcggt
gagaatcccgagatcaacacttccgacgatggtgatcatgacccgctggtgcaaggcctg
cgcgcgctggggcatcgagttaatcttgccgagcaatccagtgggctctcggcgatcacc
cgcagcgaggcgggttgggccggcggcgccgacccacgccgcgaaggcgcggtcatgggc
gacgatgcctga

DBGET integrated database retrieval system