KEGG   Mycobacterium tuberculosis CTRI-2: MTCTRI2_2490Help
Entry
MTCTRI2_2490      CDS       T01993                                 

Gene name
ndk
Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
mto  Mycobacterium tuberculosis CTRI-2
Pathway
mto00230  Purine metabolism
mto00240  Pyrimidine metabolism
mto00983  Drug metabolism - other enzymes
mto01100  Metabolic pathways
mto01110  Biosynthesis of secondary metabolites
mto01130  Biosynthesis of antibiotics
Module
mto_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
mto_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
mto_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:mto00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    MTCTRI2_2490 (ndk)
   00240 Pyrimidine metabolism
    MTCTRI2_2490 (ndk)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    MTCTRI2_2490 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mto04131]
    MTCTRI2_2490 (ndk)
Enzymes [BR:mto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     MTCTRI2_2490 (ndk)
Membrane trafficking [BR:mto04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    MTCTRI2_2490 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK TruB_C
Motif
Other DBs
NCBI-ProteinID: AEN00905
Structure
PDB: 

Position
complement(2741624..2742034)
Genome map
AA seq 136 aa AA seqDB search
MTERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRTVSAELASQHYAEHEGKPFFG
SLLEFITSGPVVAAIVEGTRAIAAVRQLAGGTDPVQAAAPGTIRGDFALETQFNLVHGSD
SAESAQREIALWFPGA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaacggactctggtactgatcaagccggatggcatcgaaaggcagctgatcggc
gagatcatcagccgcatcgagcgcaaaggcctcaccatcgctgcgctgcagctcaggacc
gtcagcgcggagttggccagccagcactacgccgaacatgaaggcaaaccattctttgga
tcgttgctggagttcatcacgtcgggtccggtggtagcggcgatcgtggagggaacccga
gccatcgcggcggttcgccaactcgccggcggcaccgacccggtgcaggcggcggcgccc
ggcacaatccggggcgacttcgctctagagacgcagttcaacctggtgcacgggtctgat
tcggccgaatccgcgcagcgcgaaatcgcgctctggtttcccggcgcctag

DBGET integrated database retrieval system