KEGG   Mycobacterium tuberculosis CTRI-2: MTCTRI2_3580Help
Entry
MTCTRI2_3580      CDS       T01993                                 

Gene name
echA19
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mto  Mycobacterium tuberculosis CTRI-2
Pathway
mto00071  Fatty acid degradation
mto00280  Valine, leucine and isoleucine degradation
mto00281  Geraniol degradation
mto00310  Lysine degradation
mto00360  Phenylalanine metabolism
mto00362  Benzoate degradation
mto00380  Tryptophan metabolism
mto00410  beta-Alanine metabolism
mto00627  Aminobenzoate degradation
mto00640  Propanoate metabolism
mto00650  Butanoate metabolism
mto00903  Limonene and pinene degradation
mto00930  Caprolactam degradation
mto01100  Metabolic pathways
mto01110  Biosynthesis of secondary metabolites
mto01120  Microbial metabolism in diverse environments
mto01130  Biosynthesis of antibiotics
mto01212  Fatty acid metabolism
Module
mto_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mto00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MTCTRI2_3580 (echA19)
   00650 Butanoate metabolism
    MTCTRI2_3580 (echA19)
  Lipid metabolism
   00071 Fatty acid degradation
    MTCTRI2_3580 (echA19)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MTCTRI2_3580 (echA19)
   00310 Lysine degradation
    MTCTRI2_3580 (echA19)
   00360 Phenylalanine metabolism
    MTCTRI2_3580 (echA19)
   00380 Tryptophan metabolism
    MTCTRI2_3580 (echA19)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MTCTRI2_3580 (echA19)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MTCTRI2_3580 (echA19)
   00281 Geraniol degradation
    MTCTRI2_3580 (echA19)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MTCTRI2_3580 (echA19)
   00627 Aminobenzoate degradation
    MTCTRI2_3580 (echA19)
   00930 Caprolactam degradation
    MTCTRI2_3580 (echA19)
Enzymes [BR:mto01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MTCTRI2_3580 (echA19)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEN01979
Position
3938012..3938803
Genome map
AA seq 263 aa AA seqDB search
MESGPDALVERRGHTLIVTMNRPAARNALSTEMMRIMVQAWDRVDNDPDIRCCILTGAGG
YFCAGMDLKAATQKPPGDSFKDGSYDPSRIDALLKGRRLTKPLIAAVEGPAIAGGTEILQ
GTDIRVAGESAKFGISEAKWSLYPMGGSAVRLVRQIPYTLACDLLLTGRHITAAEAKEMG
LIGHVVPDGQALTKALELADAISANGPLAVQAILRSIRETECMPENEAFKIDTQIGIKVF
LSDDAKEGPRAFAEKRAPNFQNR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtggaatccggacccgacgcgctggtggagcggcgcggccacaccctgatcgtgaccatg
aaccggccggccgcccgcaacgcgctgagcaccgaaatgatgcgaatcatggtgcaggcc
tgggatcgcgtcgacaacgatcccgacatccgttgctgcatcctcaccggagccggtggc
tacttttgcgccggcatggacctcaaggcggcaacccagaaaccgccgggcgactctttc
aaggacggcagctacgacccgtcgcgcatcgatgccctgctcaaagggcgccgcttgacc
aaaccgctgatcgccgccgtcgaggggcccgcgatcgccggcggcaccgagatcctgcag
ggcaccgacatccgggtcgccggtgaaagtgcgaagttcggcatctccgaggccaagtgg
agcctgtacccgatgggcggctcggccgtgcggctggtccggcagatcccctacactctg
gcctgcgacctgctgctgaccggacggcacattaccgccgccgaggccaaggaaatgggc
ctgatcggccacgtggtgcccgacggccaggcgctgaccaaggctctagaacttgccgac
gccatctcggctaacggacccctggccgtgcaggccatcctgcggtccatccgcgagacc
gagtgcatgcccgaaaacgaggcgttcaagatcgacacccagatcggcatcaaggtcttc
ctgtccgacgacgccaaggaaggcccgcgcgcgttcgccgagaagcgcgcacccaacttc
cagaaccgctag

DBGET integrated database retrieval system