KEGG   Methanothrix thermoacetophila: Mthe_0385Help
Entry
Mthe_0385         CDS       T00417                                 

Definition
(GenBank) adenosylcobyric acid synthase (glutamine-hydrolysing)
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
mtp  Methanothrix thermoacetophila
Pathway
mtp00860  Porphyrin and chlorophyll metabolism
mtp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mthe_0385
Enzymes [BR:mtp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     Mthe_0385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA SNO MobB GATase DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: ABK14178
UniProt: A0B654
Position
389194..390666
Genome map
AA seq 490 aa AA seqDB search
MTKYLIILGTTSHSGKSILVTALCRMLKNRGLRVAPFKSQNMSLNSWVTTSGGEIGIAQA
VQAWAAGVEPSVLMNPILLKPKGDRTSQVIIMGRPVADKSAADYYKDIDSLKEVVDSAIE
ELSRDYDYIIVEGAGGAAEINLFDRDIANIYVASRLRAPIILVGDIERGGVFASLYGTVK
LLPPEIRELVKGMVINKFRGDPTILQPGIKMLEELTGIPVLGILPYLDLQIPSEDSVSLL
DKTGPQKEQKEDLPEIAIIKLPRISNFTDFEPLERYARVRYVDLKDDLGNPDAVIIPGTK
NTVSDLAEMRRHGMDRKILSLKNVPIIGICGGYQILGREIIDCGIEDICGSIPGLGLIDA
VTRFDAYEKRTVQVTKEVTGDGPILGRIKGEYVKGYEIHMGITESRERSAFGDDGAVAGD
GMVIGTYLHGLFENENFRNAFLDYLYDQRGLMRRELSRDTGFDALSEAVERHLDMKSILK
MLELDVSASK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagtacctgatcattcttggaacaacatcacactccgggaagagcatactggtc
accgctttatgcagaatgctcaaaaaccgcgggcttcgcgtcgctccattcaagtcgcag
aacatgagcctgaactcgtgggtgacaacctcaggaggagagattgggatagcccaggcg
gtgcaggcatgggctgccggcgtggagccatctgttctcatgaaccccatactgctcaag
ccaaagggagaccgcacatcccaggtcataataatggggagaccagtggcagacaagtcg
gctgctgattactataaggatatagacagcctgaaggaggttgtcgattcagcgatcgag
gagctgagcagggattacgattacatcatcgttgagggcgcaggcggggcggctgagata
aacctcttcgacagagatatcgcgaacatatacgtcgcatccaggctcagagcacccata
atactcgtgggggatatcgagaggggtggggtcttcgcgagcctctacgggactgtgaag
ctcctcccgcctgagataagagagctcgtgaaggggatggtcataaacaagttccgcgga
gatcccacgatacttcagccgggcataaaaatgctggaggagctaacagggatccctgtg
cttgggattctcccttacctggatctccagataccctctgaggattctgtatcgctcttg
gacaagacgggcccacaaaaagaacaaaaagaggacctgccggagatagccatcataaag
ttacccaggatatcgaacttcacagacttcgagccactggagcgatacgcaagggtccgc
tacgtagatctgaaggacgatctcggaaacccagatgctgttataatacctggcacaaag
aacacggtctcagatcttgctgagatgaggaggcacggaatggatcgcaagatcctctct
ttaaagaacgtcccgataattggaatctgtggagggtatcagattctcggaagggagatc
attgactgcggaatagaggacatctgcggatccattcccgggctggggctcatcgatgcc
gtgacgcgatttgatgcgtatgagaagaggactgttcaggtgacaaaagaggtcactggc
gatgggccgatacttggaaggataaagggagagtatgtaaagggatacgagatacatatg
gggatcacagagtcgagggagagaagcgcattcggtgatgatggcgctgttgcgggggat
ggaatggtgataggcacctaccttcacggcctctttgagaacgagaacttcaggaacgcg
tttctcgattacctctacgatcaaagggggctcatgcgccgggagctctcgcgcgatacc
ggcttcgatgcactctcagaggctgtggagaggcatctcgacatgaaaagcatactgaaa
atgctggagctggatgtctcagccagtaaatga

DBGET integrated database retrieval system