KEGG   Methanothrix thermoacetophila: Mthe_0454Help
Entry
Mthe_0454         CDS       T00417                                 

Definition
(GenBank) diaminopimelate epimerase
  KO
K01778  diaminopimelate epimerase [EC:5.1.1.7]
Organism
mtp  Methanothrix thermoacetophila
Pathway
mtp00300  Lysine biosynthesis
mtp01100  Metabolic pathways
mtp01110  Biosynthesis of secondary metabolites
mtp01120  Microbial metabolism in diverse environments
mtp01130  Biosynthesis of antibiotics
mtp01230  Biosynthesis of amino acids
Module
mtp_M00527  Lysine biosynthesis, DAP aminotransferase pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mtp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Mthe_0454
Enzymes [BR:mtp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.7  diaminopimelate epimerase
     Mthe_0454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAP_epimerase Pro_racemase
Motif
Other DBs
NCBI-ProteinID: ABK14245
UniProt: A0B6C1
Position
complement(470142..470981)
Genome map
AA seq 279 aa AA seqDB search
MNQLEFVKLHGNGNDFILIDELNGERIPEDEKSEASRILCHRNFGIGGDGVLFLVPSERA
DIGMRLFQPDGSEAEMCGNGIRCLAKHAWESGYVGERFSVETLAGVIPIQVRRDRKGFWA
RVEMGIPRFERSEIPADGEGTFLKVPLHGFEVSAVNTGVPHAVIFVENLDIPVEQIAPKI
RHSSCFPEGANVNFVRLGNHLEVRTFERGVEAETLSCGTGSVAAAAVARRLGLVGETVEV
MTKGGPLRISFAGEKAFMEGPAVTVCRGVVSDEILQTLQ
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagctggagttcgtgaagcttcatgggaatgggaatgatttcatactcatagat
gagctgaacggggagaggataccggaagatgagaaaagcgaggcttccaggattctgtgc
catcgcaacttcggcatcggcggcgacggggttctctttctcgtaccctcagaaagagcg
gatatcggcatgcgccttttccagccggacggatctgaggccgagatgtgtgggaatggg
atacgctgcctcgcaaagcacgcgtgggagagcggctatgtgggggagagattctctgtt
gagacgctggccggcgtgatccccatccaggtcagaagggatcgcaagggattctgggcg
agggttgagatgggcatcccgagattcgagcgctctgagattcccgctgatggcgagggg
acgttcctgaaggtaccactccacggcttcgaggtatcagctgtgaacaccggcgtcccg
catgctgtgatattcgtcgaaaatctggatatccctgtagagcagatcgcccccaagatc
aggcacagctcctgcttcccggagggggcgaacgtgaactttgtgaggttggggaatcat
cttgaggtgagaaccttcgagcgcggggtcgaggccgagacgctctcgtgcggcacaggc
tctgtggcagcggctgcagtcgcgcgaagacttggccttgtgggcgagacggttgaggtc
atgacgaagggcggacccttgcgcatctcgtttgcaggagagaaggccttcatggagggg
ccggctgtgaccgtctgcaggggcgttgtctccgatgagattctgcagacgctgcagtag

DBGET integrated database retrieval system