KEGG   Methanosaeta thermophila: Mthe_0778Help
Entry
Mthe_0778         CDS       T00417                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mtp  Methanosaeta thermophila
Pathway
mtp00010  Glycolysis / Gluconeogenesis
mtp00071  Fatty acid degradation
mtp00350  Tyrosine metabolism
mtp00625  Chloroalkane and chloroalkene degradation
mtp00626  Naphthalene degradation
mtp01100  Metabolic pathways
mtp01110  Biosynthesis of secondary metabolites
mtp01120  Microbial metabolism in diverse environments
mtp01130  Biosynthesis of antibiotics
mtp01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mtp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mthe_0778
  Lipid metabolism
   00071 Fatty acid degradation
    Mthe_0778
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mthe_0778
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mthe_0778
   00626 Naphthalene degradation
    Mthe_0778
Enzymes [BR:mtp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mthe_0778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ABK14568
UniProt: A0B794
Position
825265..826266
Genome map
AA seq 333 aa AA seqDB search
MLSMRAMLLERPGEPLRLREVEIPTPGEREVLISVSACGVCRTDLHILDGELAEPKLPLI
PGHEIVGRVVAKGENAERFSTGDRIGVPWLGYTDESCRYCLRGEENLCDNARFTGYTIDG
GYAEYTVADERYCLPIPERYDDLRAAPLLCAGLIGYRSYRLALSKPGVERLGIYGFGAAA
HIIAQVALFEGIDVYAFTRPGDLEAQEFALSLGAAWAGGSDEMPPQELDAAIIFAPVGSL
VPAALRAVSKGGTVVCGGIHMSDIPSFPYSMLWEERSIRSVANLTRRDGEEFISLARDLH
IRTEIQEFGLDEANVALDLLRAGRLQGAAVLKI
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgttatccatgagagccatgctgcttgagagaccaggtgagcctctgaggttgcgggag
gttgagatacccacccctggcgagcgggaggtcctgatcagcgtgagcgcatgcggcgtc
tgccgcaccgatctccacatactcgatggggagctcgccgaaccgaagctacctctcata
ccaggccacgagatcgtggggagggtcgtggcgaaaggagagaatgcagagcgcttcagt
accggtgataggatcggagttccatggctcggatacacagatgaatcatgcaggtactgc
ctgcgtggagaggagaacctatgcgataacgcgcggttcaccggatacacgatcgatggt
ggatatgcagagtatacagttgcagacgagcgctactgcctccccatcccagagagatac
gatgatctgagagcagcgcccctgctctgcgccggattgatcggatacagatcatacaga
ctcgccctctcgaagcccggcgttgagcggctgggtatatacggatttggggctgccgct
cacataatcgcgcaggtcgctctcttcgagggtatagatgtttacgcgttcacacggcca
ggagacctggaggcgcaggagttcgccctctcactcggcgctgcatgggctgggggatca
gatgagatgccacctcaggagctggacgctgcgatcatattcgctcctgtcggctccctc
gttccggctgccctcagagctgtatctaagggagggactgttgtttgcggtgggattcac
atgtcagacataccatcctttccctacagcatgctctgggaggagcgaagcatcaggtcg
gttgcaaacctcacccgaagggatggcgaggagttcatctcactcgccagagatctccac
atcagaacagagatccaggagtttgggctcgatgaggcgaatgtggccctggatctgctg
agggcaggcaggctgcagggggctgcagtcttaaagatctga

DBGET integrated database retrieval system