KEGG   Methanothrix thermoacetophila: Mthe_0936Help
Entry
Mthe_0936         CDS       T00417                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase, degradative
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
mtp  Methanothrix thermoacetophila
Pathway
mtp00900  Terpenoid backbone biosynthesis
mtp01110  Biosynthesis of secondary metabolites
mtp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mtp00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mthe_0936
Enzymes [BR:mtp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     Mthe_0936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: ABK14724
UniProt: A0B7Q0
Position
1020938..1022197
Genome map
AA seq 419 aa AA seqDB search
MMSSRLPGFYKLPPDERLGKIVEACGDAEIKEMIKSGLSLDQADKMVENVIGLFQVPLGV
ATNFIIDGREVLVPMATEEPSVIAAASNGARMARDGGGFFTSSTGPVMRAQIQAVDLKDP
YGARCRILEHSSEITKIANEVDPMLVRLGGGAVGLEVHVIDSRAGPMVVTHLLVDCRDAM
GANAVNTMAEAVAPEIERLTGGKVHLRIISNLADTRLARARAVFKADAIGGAEVVSAIFK
TAALAEVDPYRAATHNKGIMNGVTALVLATGNDTRAVEAGAHAYAARSGRYASLSRYEID
ENGDLVGTIELPMAVGLVGGATRVHPVARAAVRMLGVRSADELSRVIAAVGLAQNFAALR
ALATEGIQRGHMSLHARNVALQAGARGEMVEIIAERMASERRINLERASELLRELGGSS
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgatgagttcaagacttccgggattctacaagctgcctcccgatgagcggctcgggaag
atcgttgaggcctgcggtgatgctgagataaaggagatgataaagagcggtttgagcctg
gaccaggcagacaagatggtggagaacgtgatcggtctcttccaggttccgctcggcgtc
gctacaaacttcataatagacgggcgtgaggtgctggtgccaatggccacagaggagcca
tctgtcatagcagcggccagcaacggagccaggatggcgcgcgatggcgggggattcttc
accagctcgacagggccggtgatgagagcccagatacaggctgtcgatctgaaggatccg
tatggcgccaggtgcaggatcctggagcattcgtctgaaataacaaaaatcgcaaacgag
gtcgacccgatgctcgtcaggctcggcgggggagctgtgggcctggaggttcatgtcatc
gattccagagccggtccgatggtcgtcacgcatctcctggtcgactgcagggatgcgatg
ggcgcgaacgctgtgaacacgatggcagaggctgtggcccctgagatcgagcggcttaca
ggcgggaaggttcacctccggataatctcaaacctggcggacacgcgcctcgccagagcg
cgggcggttttcaaggcagatgcgatcggcggggctgaggtcgtctccgcgatcttcaag
accgcagcgctcgccgaggtcgatccgtacagggccgccacgcacaacaaggggatcatg
aacggtgttacagctcttgttctcgcgacaggcaatgatacccgcgctgtcgaagcggga
gcgcatgcatacgccgccagatcagggcggtacgcatcgctatcgagatacgagatcgat
gagaatggagatcttgtgggcacgatagagcttcccatggcggttgggcttgtgggcggg
gccacgcgtgtgcatcccgtagctagggcggctgtaaggatgctcggggtgagatccgcg
gatgagctcagcagggtgatagcggcagtcggcctcgctcagaacttcgcggcgctgaga
gctctcgccacagagggcatccagcgggggcacatgtcgctgcacgcaagaaacgtcgcg
ctccaggcgggagcaaggggagagatggtggagatcatcgctgagaggatggcatccgag
cggaggattaacctggagagagcatccgagcttctcagagagctgggtggttcctcttga

DBGET integrated database retrieval system