KEGG   Methanothrix thermoacetophila: Mthe_0944Help
Entry
Mthe_0944         CDS       T00417                                 

Definition
(GenBank) glycosyl transferase, family 4
  KO
K01001  UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase [EC:2.7.8.15]
Organism
mtp  Methanothrix thermoacetophila
Pathway
mtp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mtp01003]
    Mthe_0944
Enzymes [BR:mtp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.15  UDP-N-acetylglucosamine---dolichyl-phosphate N-acetylglucosaminephosphotransferase
     Mthe_0944
Glycosyltransferases [BR:mtp01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   Mthe_0944
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_4
Motif
Other DBs
NCBI-ProteinID: ABK14732
UniProt: A0B7Q8
Position
1030565..1031539
Genome map
AA seq 324 aa AA seqDB search
MLYISVPVSVAATWIATWKWIRKAPEVGLLGWDMHKPGRPKVPEMGGVPLVFGFVLGVLV
YIGIETFYLNSYRYTPILAALCTVLMACIIGIMDDILGWKAGLRQWQKPMFMLFAAMPMM
VINAGHTTMSLPLIGRVDWGILYPLVIIPIGVVGASNAFNMVAGYNGLEAGMGVIIFAAL
GYAGLVMGKTSAAALSIIMLGSLLAFLYFNRYPARVFPGDTMTYSVGALAACVAILGDIE
KIAVTLFIPYAIDFFMQARGRFGKEAFANLGDDGSLSQSGIYHLTHLAIALLRRLKGRVY
ERDVVLFMWGVEAVVAMLSIYAYL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtgctttacatcagcgttcctgtcagcgttgcagcgacatggatagcgacgtggaagtgg
atccgcaaggctccagaggtcggtcttctgggatgggacatgcacaagcccgggcggccg
aaggtgccggagatgggcggcgtgcctcttgtgtttggctttgtgctcggggttcttgtc
tacatcggaatcgagacgttttacctgaactcatacagatacacgccgatactggcggca
ctgtgcacggttttgatggcgtgcatcatagggatcatggacgacatcctgggatggaag
gcgggcttgaggcagtggcagaaaccgatgttcatgcttttcgcagcgatgccgatgatg
gttatcaatgcaggccatacaacgatgagccttcccctgatcgggcgggtcgactggggg
atactgtatcctctcgtgatcatcccgataggggttgtgggagcctcgaacgccttcaac
atggtcgctggatacaacggccttgaggccgggatgggtgtgattatattcgcggctctt
ggctatgctggtcttgtcatggggaagacgagcgcagctgccctgtccatcataatgctc
ggctcgctgctcgccttcctgtacttcaaccggtatcctgccagggtattcccaggggac
acgatgacctactccgtgggagctctggctgcttgcgtggcgatactgggggatattgag
aagatagctgtgacactgttcataccgtatgcgatcgatttcttcatgcaggccagaggg
agatttggaaaggaggcgttcgcaaatctgggagatgatggcagcctatctcagagcggt
atctaccacctcacccatctggcgatcgctctgctcaggcgcctgaaggggagggtctac
gagagggatgttgtgctgttcatgtggggcgtggaggctgtggtggcgatgctgagcatt
tatgcgtacctctga

DBGET integrated database retrieval system