KEGG   Methanothrix thermoacetophila: Mthe_1303Help
Entry
Mthe_1303         CDS       T00417                                 

Definition
(GenBank) hypothetical protein
Organism
mtp  Methanothrix thermoacetophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF5042
Motif
Other DBs
NCBI-ProteinID: ABK15081
UniProt: A0B8Q7
Position
complement(1409898..1410359)
Genome map
AA seq 153 aa AA seqDB search
MSRSNIRKKLLGIADYYEAVFTGPRMMKHGEFRSSVLGMIIEMLDVLRINDDLRMELIRY
ITSGWRMEMVGDESAEAEMIIEKLNSVRRASMHDDMSYSLEMGVLMSLPIREMDLEEDQV
AHVYDAMNRIMEQMGCSTTEDHLVSGSEHCASS
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagatcaaacatccgcaaaaaacttctcggtattgcagattactacgaggcggtc
ttcacaggcccaaggatgatgaagcatggcgagttcaggagcagcgttctggggatgatc
atcgagatgctggacgttcttaggatcaacgacgatcttaggatggagctgataaggtac
ataacatctggatggaggatggagatggtcggcgatgagtctgcggaagcagagatgatc
atcgagaagctcaacagcgtgaggcgtgcctcaatgcatgatgatatgagctacagcctg
gagatgggtgtgctcatgtcgctcccaatccgagagatggatctggaggaggatcaggtt
gctcatgtctacgatgcgatgaacagaatcatggagcagatgggctgcagcacaacagag
gaccacctggtctcaggatctgagcactgcgccagcagttga

DBGET integrated database retrieval system