KEGG   Methanothrix thermoacetophila: Mthe_1312Help
Entry
Mthe_1312         CDS       T00417                                 

Definition
(GenBank) 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase
  KO
K11645  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
mtp  Methanothrix thermoacetophila
Pathway
mtp00010  Glycolysis / Gluconeogenesis
mtp00030  Pentose phosphate pathway
mtp00051  Fructose and mannose metabolism
mtp00680  Methane metabolism
mtp01100  Metabolic pathways
mtp01110  Biosynthesis of secondary metabolites
mtp01120  Microbial metabolism in diverse environments
mtp01130  Biosynthesis of antibiotics
mtp01200  Carbon metabolism
mtp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mthe_1312
   00030 Pentose phosphate pathway
    Mthe_1312
   00051 Fructose and mannose metabolism
    Mthe_1312
  09102 Energy metabolism
   00680 Methane metabolism
    Mthe_1312
Enzymes [BR:mtp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Mthe_1312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DeoC
Motif
Other DBs
NCBI-ProteinID: ABK15090
UniProt: A0B8R6
Position
1417592..1418398
Genome map
AA seq 268 aa AA seqDB search
MYGKMVRLERIVNRATGRSVIVPMDHGVTLGPIKGIRSMKNTVDAVASSGADAAVVHKGA
AIFGHRGYGRDLGLIIHLSASTSLGPDPNNKVLVATVEEALKLGADGVSIHVNIGAEDEA
QMLSLLGSISRSCQEWGMPLMAMMYPRGRKISNEYAEEFVGHAARVGAELGADIIKTSYT
GDPDSFSRVVDGCPVPLVVAGGPKVSSEMDLLRMVRDAVDAGASGVAIGRNIFQHENPSI
ITRRICAVVHRGYTPEEAMEIRGHEDVR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtacggaaaaatggtcaggcttgagaggatcgtgaaccgtgcgacagggcgctctgtc
atagtgccgatggatcatggtgttactctggggccgataaagggcataagatccatgaag
aatactgtggatgctgtggcgtcatctggagcagatgcggctgttgttcacaaaggcgct
gcgatattcggccaccgtggctacgggcgtgatcttggcctgataattcatctctccgcg
tccacatcgctcgggccggatccgaacaacaaggtgcttgtggccactgtggaagaggcc
ctgaagctcggagcagatggtgtcagcattcatgtcaacatcggtgcagaggacgaggca
cagatgctctccctcctcggatcaatctcaagaagctgccaggagtgggggatgccgctg
atggcgatgatgtacccccgcgggagaaagatctcgaatgagtacgcggaggagtttgtt
ggacatgcagccagggtcggcgcggagctcggggcggatatcatcaaaacatcctacact
ggggatccagacagcttctcccgagttgtggatggatgccctgtgccgctggttgtcgcg
ggcggaccgaaggtcagctcagagatggacctgctgagaatggtcagggacgccgtagat
gctggagcgagtggcgtcgccataggcaggaacatattccagcacgagaatccctcgatc
atcacgagaaggatatgcgccgtggtgcacagagggtacacgcctgaggaggcgatggag
atcagaggccatgaggatgtcaggtag

DBGET integrated database retrieval system