KEGG   Methanothrix thermoacetophila: Mthe_1316Help
Entry
Mthe_1316         CDS       T00417                                 

Definition
(GenBank) hypothetical protein
Organism
mtp  Methanothrix thermoacetophila
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABK15094
UniProt: A0B8S0
Position
complement(1423587..1424039)
Genome map
AA seq 150 aa AA seqDB search
MQSPVSIMILLTGVALIFLANASAQESVQGLSIEDVRAFHQDFLRKSSNLSLMQTDIPEI
PSASFAKLAPSSTGDLVALNSNMERDLSYGGEIAESAPRINYMDISLDKITVIAINMGRG
GSAIATSNVMITPVQSQEGYPSCSALDKLR
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcgcccgtcagcattatgattctgctgacgggtgttgcactgatttttcttgca
aatgcatctgcccaggagagcgtgcagggtctctccatagaggatgtacgggcgttccat
caggattttctccgcaaatccagcaacctgagtttaatgcagacagatatccctgagata
ccaagtgcgtctttcgccaagctcgcgccttccagcacaggagatctcgttgctctgaac
tcgaatatggagagggatctctcatacggcggcgagatcgctgagagcgcgcccaggata
aactacatggacatctctcttgacaagatcacagtcatagcgatcaacatgggcaggggc
gggagcgccatcgcgacgtccaacgtgatgataacaccggtccagtcgcaggaaggatat
ccatcatgctcagcactggataagctgagatga

DBGET integrated database retrieval system