KEGG   Methanothrix thermoacetophila: Mthe_1321Help
Entry
Mthe_1321         CDS       T00417                                 

Definition
(GenBank) DNA-directed RNA polymerase, subunit E'
  KO
K03049  DNA-directed RNA polymerase subunit E' [EC:2.7.7.6]
Organism
mtp  Methanothrix thermoacetophila
Pathway
mtp00230  Purine metabolism
mtp00240  Pyrimidine metabolism
mtp01100  Metabolic pathways
mtp03020  RNA polymerase
Module
mtp_M00184  RNA polymerase, archaea
Brite
KEGG Orthology (KO) [BR:mtp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Mthe_1321
   00240 Pyrimidine metabolism
    Mthe_1321
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    Mthe_1321
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mtp03021]
    Mthe_1321
Enzymes [BR:mtp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     Mthe_1321
Transcription machinery [BR:mtp03021]
 Prokaryotic type
  Archaeal type
   RNA polymerase
    Core subunits
     Mthe_1321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SHS2_Rpb7-N S1 RNA_pol_Rbc25 DUF826 S1_2
Motif
Other DBs
NCBI-ProteinID: ABK15099
UniProt: A0B8S5
Position
1428435..1429055
Genome map
AA seq 206 aa AA seqDB search
MYKRMKLEGVVRIPPEDMGNPLNDAVEMALRNKYEARVDRTLGAIVAILGVDSIGEGRII
AGDGAVYYDVIFDAVVFKPEMQEVVEGEVVEIVKFGAFVSIGPFDGLLHVSQITDEYMAY
DEKNARLVSKDTNKFLAEGDRVRARIIAVSLNERDPKGSKIGLTMRQTGLGKIEWLEALR
RGEISEAKAEVKEQVEERAEQKAEAE
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaaagaatgaagcttgagggtgttgtgagaataccccctgaggatatgggcaat
cccttgaacgacgcggtggagatggccctccggaataagtatgaggcaagagtcgacagg
acgcttggcgccattgtggccatcctcggcgttgacagcataggagagggccgcataata
gctggcgatggcgctgtgtattacgatgtgatatttgatgcggtggtcttcaagccggag
atgcaggaggtcgtggagggggaggtcgtcgagatagtcaagttcggtgcattcgtgagc
ataggaccgttcgatggtctgcttcacgtgagccagataacagatgagtacatggcatac
gatgagaagaacgccaggcttgtgagcaaggacacgaacaagttcctggcggagggtgat
agggtccgagccaggataatagccgtgagtcttaatgagagagatcctaagggtagcaag
atcgggctcacgatgcgtcagacaggccttggaaagatcgagtggcttgaggccctccga
cgtggtgaaatctcagaggcaaaggcagaggtgaaggagcaggtggaggagagggccgag
cagaaggcggaggctgaatga

DBGET integrated database retrieval system