KEGG   Methanothrix thermoacetophila: Mthe_1334Help
Entry
Mthe_1334         CDS       T00417                                 

Definition
(GenBank) hypothetical protein
Organism
mtp  Methanothrix thermoacetophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Clathrin
Motif
Other DBs
NCBI-ProteinID: ABK15110
UniProt: A0B8T6
Position
1438208..1438816
Genome map
AA seq 202 aa AA seqDB search
MRERFDEMGPEQRLEYVIENLRSLPAELVEPAIDLLLRANEIEYAVVLCREHGMIQRAVD
ILVDAGDYLWAAQITKSAGSPEEAERLLRSGLEYYISMEMYGRAISAATALNLPPDQIDA
LYREGIAFESKSMDLSRAHAALESMMSAVAMLETDEEVKRELMDAIQEELDRERGSAEAT
APPANRSQLRREDDKIDGDRFC
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagagagagatttgatgagatggggcctgagcagaggcttgagtatgtcatagagaac
ctgagaagcctcccggctgaacttgtggaacctgcgatagacctcttgctgagggcgaac
gagatcgaatacgctgtagtgctctgcagggagcatggcatgatccagagggctgtcgat
attctggtggatgctggggactacctctgggccgctcagatcacgaagagcgcgggatcc
cctgaggaggcggaacggctgctgcgcagcggtctcgagtactacatatcgatggagatg
tacggaagggccataagcgctgcaactgccctgaacctgcctccggatcagatagacgcc
ctctacagggagggcatcgccttcgagagcaagagcatggatctgagcagggcacatgca
gccctggagagcatgatgtctgctgttgcgatgctggagaccgatgaggaagtgaagagg
gagctgatggatgcgatacaggaggagcttgacagagagcgcggctcagctgaagcgaca
gctccgcccgcgaacaggtcccagctcagaagagaagatgacaagatcgatggagaccgc
ttctgctga

DBGET integrated database retrieval system