KEGG   Methanothrix thermoacetophila: Mthe_1338Help
Entry
Mthe_1338         CDS       T00417                                 

Definition
(GenBank) 4Fe-4S ferredoxin, iron-sulfur binding domain protein
Organism
mtp  Methanothrix thermoacetophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_6 Fer4 Fer4_2 Fer4_11 Fer4_7 Fer4_9 Fer4_10 Fer4_4 Fer4_16 Fer4_21 Fer4_15 Fer4_3 Fer4_17
Motif
Other DBs
NCBI-ProteinID: ABK15113
UniProt: A0B8T9
Position
complement(1441868..1442311)
Genome map
AA seq 147 aa AA seqDB search
MAKIYLDPERCIGCRSCEVACEREHGHPRISVGIVGDLAAVPVYCHQCDTSPCTAVCYTG
SLRLDGDMVAFDQDLCTRCGLCVVACPFGAIELRSMIQRCDLCIEKETPICVMTCPAEAL
RLGDVDVVSRSTRRRAAGALAARLVRI
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagatatacctggaccctgagaggtgtatcggatgccgctcatgtgaggtcgcg
tgcgagagggagcacgggcatccacgcatatctgtgggcatcgtgggcgatctggcagct
gtgcctgtgtactgccatcagtgcgatacctctccatgcaccgctgtctgctacaccggc
tcactgaggctggatggcgatatggttgcattcgatcaggatctctgcacacgctgtgga
ctgtgcgtagttgcatgcccctttggggcgatagagcttcgttcaatgatacagagatgc
gatctctgtattgagaaggagacgccgatctgtgtcatgacatgtccggcggaggctctt
cggcttggtgatgtagatgtggtctccagatccaccagaaggagggctgcgggcgctctg
gcggccaggctggtgaggatatga

DBGET integrated database retrieval system