KEGG   Methanothrix thermoacetophila: Mthe_1339Help
Entry
Mthe_1339         CDS       T00417                                 

Definition
(GenBank) assimilatory nitrate reductase (NADH) alpha subunit apoprotein
  KO
K22516  formate dehydrogenase (coenzyme F420) alpha subunit [EC:1.17.98.3 1.8.98.6]
Organism
mtp  Methanothrix thermoacetophila
Pathway
mtp00680  Methane metabolism
mtp01100  Metabolic pathways
mtp01120  Microbial metabolism in diverse environments
mtp01200  Carbon metabolism
Module
mtp_M00357  Methanogenesis, acetate => methane
mtp_M00567  Methanogenesis, CO2 => methane
mtp_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mtp00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Mthe_1339
Enzymes [BR:mtp01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.98  With other, known, physiological acceptors
    1.8.98.6  formate:CoB-CoM heterodisulfide,ferredoxin reductase
     Mthe_1339
  1.17  Acting on CH or CH2 groups
   1.17.98  With other, known, physiological acceptors
    1.17.98.3  formate dehydrogenase (coenzyme F420)
     Mthe_1339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Molybdopterin Molydop_binding Molybdop_Fe4S4
Motif
Other DBs
NCBI-ProteinID: ABK15114
UniProt: A0B8U0
Position
complement(1442311..1444299)
Genome map
AA seq 662 aa AA seqDB search
MSGRTPTVCPYCAVGCGFYITRNGMEYMPDHPVNEGALCAKGNAALDILNHVERLRYPMM
RVGKDWIRVSWDEALDRVAEEMEKVLRERGPKALAFLGSAKCTNEENYIFQKIARLMGTN
NIDNCARRCHSPTIIALREMLGTPAMTNPISDLALSDCILVIGSNLAENHPVVARWILRA
KDRGAVVIVADPRVTPTSWLADLHMQLNPGTDIALINGMINVILREGLEKRAFINERTIG
FENLDLRDYTPERVSAITGLSAGDIIRAARLYARSPASSIVYCMGITQHTCGTDNVAACA
NLALVCGQIGRPGAGIFPLRGQNNVQGACDMGALADFYPGWRSVEDSRAIDDLRRLWNAR
SLPMGRGLTADLMPDADLKFLYVMGEDIVNSDPTVSRRRLKRGFMVVQDIFMTDTAKLAD
LVLPATAWAEKEGTITSTERRVQWIYRAGEPPGEARMDLWILSEVAARIGFDLASEPDEV
LAEINQAVPAYRGISRSNAGARGGIIWPCPHKDHPGTPLLHRERFSTPDGKARIIPVHHP
ALERTSTEYPLILITGRVALHYNSGSMTMRSEGLVKREPEIHIDVNPDDAMRFGLADGDA
VMVETRWGRARARAQITQGQKRGTLFMPFHFPETNLIASELLDRKAMMPELKVAACRIRR
CD
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcaggacacccacagtctgcccctactgcgctgtgggctgcgggttttacata
acccggaacggcatggagtacatgcccgaccaccctgtcaatgagggggctctctgcgcg
aagggtaatgcagcccttgatatcctgaatcacgtggagaggctgcggtatccgatgatg
agggtcggaaaggactggataagagtatcctgggacgaggcgcttgacagagtggcagag
gagatggagaaggttctgcgggagagagggccgaaggcccttgcattcctaggatccgca
aaatgcaccaacgaggagaactatattttccagaagatcgcgcgactgatggggacgaac
aacatcgataactgcgcaagacgctgccactcgccgacgatcatcgcgctgcgcgagatg
ctcggaacccccgcgatgaccaatccaatatcagatctagcgctctctgattgcattctg
gtgatcggatcgaacctggctgagaaccatcctgtggtagccaggtggatcctgagagcg
aaggacaggggcgcggttgtgatcgtagcagatccgagggtgacaccaacctcctggctc
gcagatctccacatgcagctcaaccctggcacagatatcgcgctcatcaacggcatgatc
aacgtaatactaagagaggggctggagaaaagggcattcataaatgagagaaccattgga
ttcgagaatctcgatctcagagattacacccctgagagggtatccgcgataacaggcctg
agtgctggagatatcatcagagccgcgaggctatatgcgagatctcctgcatcttcaata
gtttactgcatgggcatcacacagcacacatgcggaacagataatgtggctgcatgcgcg
aacctcgccctcgtctgcggacagattggaagacctggcgccggtatatttccgctgagg
gggcagaacaacgtccagggagcgtgcgacatgggggctctggcggatttctatcccgga
tggagatctgtggaagattccagggcgatcgatgatctcaggcgtttatggaatgcgaga
tcccttccgatggggcgcggacttaccgctgatctgatgccagacgcggatctcaagttc
ctctacgtgatgggcgaggatatcgtgaactcagatcccactgtatcccggaggaggttg
aagagaggtttcatggtcgtgcaggacatattcatgaccgacaccgcaaagcttgcggat
cttgtgctgccagcgactgcatgggcggagaaggaaggcacaatcacatcaacagagcgg
agggtccagtggatatatcgagcaggagagcctcccggggaagcgaggatggatctgtgg
attctatcagaggtggcggcacgcatcggattcgatctcgcatccgaaccggatgaggtt
ctggcggagataaaccaggcggttccagcataccgcggcatcagcaggagcaatgcagga
gctcgtggcgggatcatctggccgtgcccgcataaggatcatcccgggactcctctgctt
cacagggagaggttctccactccggatggaaaagcgagaatcattccagtccatcaccca
gcgcttgagcgcacatccacagagtacccgttgatccttatcacagggcgtgtggctctc
cactacaactcaggatcgatgaccatgagaagtgaagggcttgtgaaacgagagccggag
attcacatcgatgtgaatccagatgacgctatgcgtttcggattagctgatggtgatgcc
gtcatggtcgagactagatggggcagagcaagggcgcgagcacagatcactcaaggacag
aagcgcgggacactgttcatgccattccacttcccggagacgaacctgatcgcatcagag
cttctcgacaggaaagctatgatgcccgagctcaaggtcgccgcgtgcaggatcaggagg
tgtgattga

DBGET integrated database retrieval system