KEGG   Methanothrix thermoacetophila: Mthe_1340Help
Entry
Mthe_1340         CDS       T00417                                 

Definition
(GenBank) 4Fe-4S ferredoxin, iron-sulfur binding domain protein
  KO
K00196  anaerobic carbon-monoxide dehydrogenase iron sulfur subunit
Organism
mtp  Methanothrix thermoacetophila
Pathway
mtp00633  Nitrotoluene degradation
mtp00680  Methane metabolism
mtp00720  Carbon fixation pathways in prokaryotes
mtp01120  Microbial metabolism in diverse environments
mtp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mtp00001]
 09100 Metabolism
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mthe_1340
   00680 Methane metabolism
    Mthe_1340
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mthe_1340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_11 Fer4_7 Fer4_9 Fer4 Fer4_6 Fer4_10 Fer4_16 Fer4_2 Fer4_4 Fer4_20 Fer4_17 Fer4_3 Fer4_8 Fer4_21 Fe_dep_repr_C
Motif
Other DBs
NCBI-ProteinID: ABK15115
UniProt: A0B8U1
Position
complement(1444304..1444810)
Genome map
AA seq 168 aa AA seqDB search
MKEILVRPERCMGCRSCEIACAVEHSQSRDLFRALSEMPQKRLFVEHVPEYSLAVPILCR
HCEDAPCVAVCPTGALTQDAISGVVRHNKDICIGCWTCASVCTYGVIGRDRRARVAIKCD
RCPDLEVPACVSACPTRALIYGDVEEISSSKRAESALKVARGVAVSSR
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagatacttgttcgcccggagagatgcatgggctgccgctcctgcgagatagca
tgcgctgttgagcactcccagagcagggatctcttcagagcgttgtcagagatgccgcag
aagcgtctcttcgtggagcacgttccagagtactctctcgcggtgcccatactctgcaga
cactgcgaggatgcgccgtgcgttgcggtttgccccactggagctctgacgcaggacgcg
atctctggagtcgtgaggcacaacaaggatatctgcatcggttgctggacgtgcgcctct
gtctgcacttacggagtgattggcagggacagaagggctcgtgttgctataaaatgcgac
aggtgcccggacctggaggtacctgcctgcgtcagcgcatgtcccacacgcgccctgatc
tacggggatgttgaagagatctcgagctcgaagagggcagaatccgctctgaaggtcgcg
cggggtgtggctgtcagcagtcggtga

DBGET integrated database retrieval system